You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PTHLH
Parathyroid hormone-related protein

Protein Summary
Description
Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity). Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1. Osteos ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000201015
  • ENSP00000201015
  • ENSG00000087494
  • ENST00000395868
  • ENSP00000379209
  • ENST00000395872
  • ENSP00000379213
  • ENST00000535992
  • ENSP00000440613
  • ENST00000538310
  • ENSP00000441890
  • ENST00000539239
  • ENSP00000441571
  • ENST00000545234
  • ENSP00000441765

Symbol
  • PTHRP
  • HHM
  • PLP
  • BDE2
  • PTHR
  • PTHRP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.94
biological process
0.91
PubMedID
0.86
transcription factor perturbation
0.84
chemical
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2082.05   (req: < 5)
Gene RIFs: 158   (req: <= 3)
Antibodies: 378   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2082.05   (req: >= 5)
Gene RIFs: 158   (req: > 3)
Antibodies: 378   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Class B/2 (Secretin family receptors) (R-HSA-373080)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class B/2 (Secretin family receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Class B/2 (Secretin family receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Signal Transduction
Gene Ontology Terms (22)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (216)
1 – 10 of 216
PTH
Tbio
Novelty: 0.00003793
Score: 0.995
Data Source: STRINGDB
PTH1R
Tclin
Family: GPCR
Novelty: 0.0018948
Score: 0.992
Data Source: Reactome,STRINGDB
CALCA
Tbio
Novelty: 0.00012558
Score: 0.978
Data Source: STRINGDB
CALCA
Tclin
Novelty: 0.00012558
Score: 0.978
Data Source: STRINGDB
PTH2R
Tchem
Family: GPCR
Novelty: 0.02132997
Score: 0.974
Data Source: Reactome,STRINGDB
PTH2
Tdark
Novelty: 0.02942619
Score: 0.958
Data Source: STRINGDB
AVP
Tbio
Novelty: 0.0001163
Score: 0.952
Data Source: STRINGDB
SCTR
Tclin
Family: GPCR
Novelty: 0.02156122
Score: 0.947
Data Source: STRINGDB
ADCY3
Tbio
Family: Enzyme
Novelty: 0.00377044
Score: 0.942
Data Source: STRINGDB
IHH
Tbio
Novelty: 0.00230273
Score: 0.938
Data Source: STRINGDB
Publication Statistics
PubMed Score  2082.05

PubMed score by year
PubTator Score  1550.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTA
1-70
EIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKK
70-140
RRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
140-177
MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH