You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
IMPDH2
Inosine-5'-monophosphate dehydrogenase 2

Protein Summary
Description
Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth. Could also have a single-stranded nucleic acid-binding activity and could play a role in RNA and/or DNA metabolism. It may also have a role in the development of malignancy and the growth progression of some tumors. This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326739
  • ENSP00000321584
  • ENSG00000178035

Symbol
  • IMPD2
  • IMPD2
  • IMPDH-II
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
1
kinase perturbation
1
transcription factor perturbation
0.97
small molecule perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.6   (req: < 5)
Gene RIFs: 38   (req: <= 3)
Antibodies: 346   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.6   (req: >= 5)
Gene RIFs: 38   (req: > 3)
Antibodies: 346   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 472
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (20)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Metabolism
Metabolism of nucleotides
Neutrophil degranulation
Gene Ontology Terms (23)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (218)
1 – 10 of 218
IMPDH1
Tclin
Family: Enzyme
Novelty: 0.01078039
p_int: 0.999999974
p_ni: 2.6e-8
Score: 0.971
Data Source: BioPlex,STRINGDB
ANKRD9
Tdark
Novelty: 0.4990099
p_int: 0.998647425
p_ni: 0.001350326
p_wrong: 0.00000225
Score: 0.933
Data Source: BioPlex,STRINGDB
SLC25A44
Tdark
Family: Transporter
Novelty: 3.49104859
p_int: 0.998471197
p_ni: 0.001528803
Score: 0.847
Data Source: BioPlex,STRINGDB
SMCR8
Tbio
Novelty: 0.22705063
p_int: 0.998218405
p_ni: 0.001525461
p_wrong: 0.000256134
Score: 0.869
Data Source: BioPlex,STRINGDB
SKP2
Tbio
Family: Enzyme
Novelty: 0.00202287
p_int: 0.991856857
p_ni: 0.008143143
Score: 0.227
Data Source: BioPlex,STRINGDB
PUSL1
Tdark
Family: Enzyme
p_int: 0.964596796
p_ni: 0.035353319
p_wrong: 0.000049885
Score: 0.787
Data Source: BioPlex,STRINGDB
GMPS
Tbio
Family: Enzyme
Novelty: 0.00301335
Score: 0.995
Data Source: STRINGDB
CTPS1
Tbio
Family: Enzyme
Novelty: 0.00445558
Score: 0.979
Data Source: STRINGDB
ATIC
Tchem
Novelty: 0.00643735
Score: 0.966
Data Source: STRINGDB
ITPA
Tbio
Family: Enzyme
Novelty: 0.00285702
Score: 0.966
Data Source: STRINGDB
Publication Statistics
PubMed Score  104.60

PubMed score by year
PubTator Score  94.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPM
1-70
DTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFC
70-140
GIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP
140-210
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS
210-280
IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKV
280-350
SEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
350-420
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKF
420-490
EKRTSSAQVEGGVHSLHSYEKRLF
490-514
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF