You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC25A6
ADP/ATP translocase 3

Protein Summary
Description
Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis. This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein is implicated in the function of the permability transition pore complex (PTPC), which regulates the release of mitochondrial products that induce apoptosis. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Jun 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000381401
  • ENSP00000370808
  • ENSG00000169100

Symbol
  • ANT3
  • ANT
  • AAC3
  • ANT3
  • ANT 2
  • ANT 3
  • ANT3Y
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
hub protein
0.98
molecular function
0.88
biological process
0.84
cellular component
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 133.5   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 266   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 133.5   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 266   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (25)
Disease (R-HSA-1643685)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Disease
Reactome
HIV Infection
Reactome
Host Interactions of HIV factors
Reactome
Host Interactions with Influenza Factors
Reactome
Infectious disease
Name
Explore in Pharos
Explore in Source
Disease
HIV Infection
Host Interactions of HIV factors
Host Interactions with Influenza Factors
Infectious disease
Protein-Protein Interactions (173)
1 – 10 of 173
LRP1
Tbio
Novelty: 0.00117899
p_int: 0.975870222
p_ni: 0.024129778
Data Source: BioPlex
FAM187B
Tdark
Novelty: 0.90909091
p_int: 0.975128989
p_ni: 0.024871011
Score: 0.204
Data Source: BioPlex,STRINGDB
GLMP
Tdark
Novelty: 0.08368201
p_int: 0.969254923
p_ni: 0.030745077
Data Source: BioPlex
ISLR
Tbio
Novelty: 0.10472842
p_int: 0.959328918
p_ni: 0.040671082
Data Source: BioPlex
CLEC4C
Tbio
Novelty: 0.01109083
p_int: 0.945077329
p_ni: 0.054922671
Data Source: BioPlex
DKK3
Tbio
Novelty: 0.00427648
p_int: 0.939038617
p_ni: 0.060961383
Score: 0.164
Data Source: BioPlex,STRINGDB
ORAI1
Tchem
Family: IC
Novelty: 0.00209003
p_int: 0.936370651
p_ni: 0.063629349
Data Source: BioPlex
VSIG4
Tbio
Novelty: 0.01760839
p_int: 0.935868335
p_ni: 0.064131665
Data Source: BioPlex
CHRM4
Tclin
Family: GPCR
Novelty: 0.01206378
p_int: 0.93530661
p_ni: 0.06469339
Data Source: BioPlex
OSTM1
Tbio
Novelty: 0.04716423
p_int: 0.935169694
p_ni: 0.064830306
Data Source: BioPlex
Publication Statistics
PubMed Score  133.50

PubMed score by year
PubTator Score  842.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSF
1-70
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
70-140
LAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHI
140-210
VVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLR
210-280
GMGGAFVLVLYDELKKVI
280-298
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI