You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PABPC1
Polyadenylate-binding protein 1

Protein Summary
Description
Binds the poly(A) tail of mRNA, including that of its own transcript. May be involved in cytoplasmic regulatory processes of mRNA metabolism such as pre-mRNA splicing. Its function in translational initiation regulation can either be enhanced by PAIP1 or repressed by PAIP2. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo. Involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Involved in regulation of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons; for the recognition of premature termination codons (PTC) and initiation of NMD a competitive interaction between UPF1 and PABPC1 with the ribosome-bound release factors is proposed. By binding to long poly(A) tails, may protect them from uridylation by ZCCHC6/ZCCHC11 and hence contribute to mRN ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318607
  • ENSP00000313007
  • ENSG00000070756

Symbol
  • PAB1
  • PABP1
  • PABPC2
  • PAB1
  • PABP
  • PABP1
  • PABPC2
  • PABPL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
hub protein
0.99
transcription factor binding site profile
0.96
transcription factor perturbation
0.94
biological process
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 412.22   (req: < 5)
Gene RIFs: 69   (req: <= 3)
Antibodies: 211   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 412.22   (req: >= 5)
Gene RIFs: 69   (req: > 3)
Antibodies: 211   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (27)
1 – 5 of 27
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (25)
AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 19
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AUF1 (hnRNP D0) binds and destabilizes mRNA
Reactome
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Reactome
Axon guidance
Reactome
Cap-dependent Translation Initiation
Reactome
Deadenylation of mRNA
Name
Explore in Pharos
Explore in Source
AUF1 (hnRNP D0) binds and destabilizes mRNA
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S
Axon guidance
Cap-dependent Translation Initiation
Deadenylation of mRNA
Protein-Protein Interactions (441)
1 – 10 of 441
GSPT2
Tbio
Family: Enzyme
Novelty: 0.12428326
p_int: 0.986080615
p_ni: 0.013919385
Score: 0.999
Data Source: BioPlex,STRINGDB
LARP4B
Tbio
Novelty: 0.153294
p_int: 0.926662479
p_ni: 0.073337521
Score: 0.97
Data Source: BioPlex,STRINGDB
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.865060978
p_ni: 0.134939022
Score: 0.579
Data Source: BioPlex,STRINGDB
TRA2A
Tbio
Novelty: 0.08069721
p_int: 0.788966729
p_ni: 0.211033271
Score: 0.627
Data Source: BioPlex,STRINGDB
SNRNP70
Tbio
Novelty: 0.00199593
p_int: 0.782093798
p_ni: 0.217906202
Score: 0.448
Data Source: BioPlex,STRINGDB
EIF4G1
Tbio
Novelty: 0.00219215
Score: 0.999
Data Source: Reactome,STRINGDB
RBM8A
Tbio
Novelty: 0.00069289
Score: 0.999
Data Source: STRINGDB
GSPT1
Tbio
Family: Enzyme
Novelty: 0.04456917
Score: 0.999
Data Source: STRINGDB
SMG1
Tchem
Family: Kinase
Novelty: 0.01292797
Score: 0.999
Data Source: STRINGDB
PAIP1
Tbio
Novelty: 0.08311173
Score: 0.997
Data Source: STRINGDB
Publication Statistics
PubMed Score  412.22

PubMed score by year
PubTator Score  239.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALD
1-70
TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGY
70-140
GFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDL
140-210
FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKF
210-280
EQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV
280-350
TEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
350-420
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM
420-490
GPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQ
490-560
MLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSA
560-630
TGVPTV
630-636
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV