You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
PSKH1
Serine/threonine-protein kinase H1

Protein Summary
Description
May be a SFC-associated serine kinase (splicing factor compartment-associated serine kinase) with a role in intranuclear SR protein (non-snRNP splicing factors containing a serine/arginine-rich domain) trafficking and pre-mRNA processing.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000291041
  • ENSP00000291041
  • ENSG00000159792
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.91
protein domain
0.85
tissue sample
0.7
histone modification site profile
0.63
cellular component
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.38   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 123   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.38   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 123   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (22)
1 – 10 of 22
UNC119
Tchem
Novelty: 0.01278653
p_int: 0.997285752
p_ni: 1.4e-7
p_wrong: 0.002714108
Score: 0.319
Data Source: BioPlex,STRINGDB
EFCAB2
Tdark
Novelty: 0.46545992
Score: 0.776
Data Source: STRINGDB
LCAT
Tbio
Family: Enzyme
Novelty: 0.00426362
Score: 0.764
Data Source: STRINGDB
SLC12A4
Tbio
Family: Transporter
Novelty: 0.01717672
Score: 0.764
Data Source: STRINGDB
PSMB10
Tchem
Family: Enzyme
Novelty: 0.01328435
Score: 0.753
Data Source: STRINGDB
SLC12A2
Tclin
Family: Transporter
Novelty: 0.00068362
Score: 0.744
Data Source: STRINGDB
SLC12A3
Tclin
Family: Transporter
Novelty: 0.0014922
Score: 0.64
Data Source: STRINGDB
CMPK1
Tbio
Family: Kinase
Novelty: 0.01022104
Score: 0.632
Data Source: STRINGDB
TSTD2
Tdark
Family: Enzyme
Novelty: 4
Score: 0.573
Data Source: STRINGDB
PPEF2
Tbio
Family: Enzyme
Novelty: 0.30314948
Score: 0.515
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.38

PubMed score by year
PubTator Score  4.99

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAGFPAASQYAHPCPGPPTAGH
1-70
TEPPSEPPRRARVAKYRAKFDPRVTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVC
70-140
ESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLH
140-210
ALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDM
210-280
WALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQAL
280-350
RHPWVVSMAASSSMKNLHRSISQNLLKRASSRCQSTKSAQSTRSSRSTRSNKSRRVRERELRELNLRYQQ
350-420
QYNG
420-424
MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAGFPAASQYAHPCPGPPTAGHTEPPSEPPRRARVAKYRAKFDPRVTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWVVSMAASSSMKNLHRSISQNLLKRASSRCQSTKSAQSTRSSRSTRSNKSRRVRERELRELNLRYQQQYNG