You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ADH5
Alcohol dehydrogenase class-3

Protein Summary
Description
Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione. This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. [provided by RefSe ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296412
  • ENSP00000296412
  • ENSG00000197894

Symbol
  • ADHX
  • FDH
  • FDH
  • ADHX
  • ADH-3
  • FALDH
  • GSNOR
  • GSH-FDH
  • HEL-S-60p
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.97
disease perturbation
0.95
protein domain
0.92
molecular function
0.91
transcription factor perturbation
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 352.13   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 380   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 352.13   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 380   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 31
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (95)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Ethanol oxidation
Reactome
Metabolism
Reactome
Phase I - Functionalization of compounds
Name
Explore in Pharos
Explore in Source
Biological oxidations
Ethanol oxidation
Metabolism
Phase I - Functionalization of compounds
Gene Ontology Terms (19)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (138)
1 – 10 of 138
ESD
Tbio
Family: Enzyme
Novelty: 0.00436323
Score: 0.999
Data Source: STRINGDB
ALDH9A1
Tbio
Family: Enzyme
Novelty: 0.02297759
Score: 0.968
Data Source: STRINGDB
CYP2E1
Tchem
Novelty: 0.00037342
Score: 0.953
Data Source: STRINGDB
AOX1
Tbio
Family: Enzyme
Novelty: 0.00323057
Score: 0.94
Data Source: STRINGDB
CYP26A1
Tchem
Family: Enzyme
Novelty: 0.00347611
Score: 0.933
Data Source: STRINGDB
ALDH2
Tclin
Family: Enzyme
Novelty: 0.00094367
Score: 0.924
Data Source: STRINGDB
ADHFE1
Tbio
Family: Enzyme
Novelty: 0.042113
Score: 0.92
Data Source: STRINGDB
RETSAT
Tdark
Family: Enzyme
Novelty: 0.14624727
Score: 0.919
Data Source: STRINGDB
LRAT
Tbio
Family: Enzyme
Novelty: 0.02898976
Score: 0.916
Data Source: STRINGDB
BCO1
Tbio
Family: Enzyme
Novelty: 0.00308805
Score: 0.912
Data Source: STRINGDB
Publication Statistics
PubMed Score  352.13

PubMed score by year
PubTator Score  214.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGA
1-70
GIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHY
70-140
MGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMG
140-210
CKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALE
210-280
ACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL
280-350
SFDEINKAFELMHSGKSIRTVVKI
350-374
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVVKI