You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
TOP1
DNA topoisomerase 1

Protein Summary
Description
Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity). Regulates the alternative splicing of tissue factor (F3) pre-mRNA in endothelial cells. Involved in the circadian transcription of the core circadian clock component ARNTL/BMAL1 by altering the chromatin structure around the ROR resp ...more
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
1
interacting protein
1
protein domain
1
transcription factor perturbation
0.96
molecular function
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4256.55   (req: < 5)
Gene RIFs: 180   (req: <= 3)
Antibodies: 382   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4256.55   (req: >= 5)
Gene RIFs: 180   (req: > 3)
Antibodies: 382   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 139
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (15)
1 – 5 of 15
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
SUMO E3 ligases SUMOylate target proteins
Reactome
SUMOylation
Reactome
SUMOylation of DNA replication proteins
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational protein modification
SUMO E3 ligases SUMOylate target proteins
SUMOylation
SUMOylation of DNA replication proteins
Gene Ontology Terms (32)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Protein-Protein Interactions (286)
1 – 10 of 286
EAF1
Tbio
Novelty: 0.86956522
p_int: 0.99560056
p_ni: 0.00439944
Data Source: BioPlex
ZRANB2
Tbio
Novelty: 0.02084407
p_int: 0.992838763
p_ni: 0.007161237
Score: 0.556
Data Source: BioPlex,STRINGDB
ESAM
Tbio
Novelty: 0.00636783
p_int: 0.952336066
p_ni: 0.047663934
Score: 0.19
Data Source: BioPlex,STRINGDB
CIDEC
Tbio
Novelty: 0.01333028
p_int: 0.910968099
p_ni: 0.089031901
Score: 0.252
Data Source: BioPlex,STRINGDB
HDGFL2
Tbio
Family: Epigenetic
Novelty: 0.12835229
p_int: 0.901074525
p_ni: 0.098925475
Data Source: BioPlex
SNRPGP15
Tdark
p_int: 0.89344272
p_ni: 0.10655728
Data Source: BioPlex
PRICKLE3
Tdark
Novelty: 0.43613707
p_int: 0.882610129
p_ni: 0.117389871
Data Source: BioPlex
DUS4L
Tbio
Family: Enzyme
Novelty: 0.06032049
p_int: 0.860040648
p_ni: 0.139959352
Score: 0.209
Data Source: BioPlex,STRINGDB
GTF2E2
Tbio
Novelty: 0.16730745
p_int: 0.809584398
p_ni: 0.190415602
Score: 0.219
Data Source: BioPlex,STRINGDB
TOP2A
Tclin
Family: Enzyme
Novelty: 0.00121459
Score: 0.997
Data Source: STRINGDB
Publication Statistics
PubMed Score  4256.55

PubMed score by year
PubTator Score  69.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHK
1-70
DGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPR
70-140
DEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEER
140-210
YPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFK
210-280
DWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERI
280-350
ANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
350-420
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAG
420-490
NEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQP
490-560
EDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILC
560-630
NHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMK
630-700
LEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
700-765
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF