You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACADM
Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

Protein Classes
Protein Summary
Description
Acyl-CoA dehydrogenase specific for acyl chain lengths of 4 to 16 that catalyzes the initial step of fatty acid beta-oxidation. Utilizes the electron transfer flavoprotein (ETF) as an electron acceptor to transfer electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase). This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370841
  • ENSP00000359878
  • ENSG00000117054
  • ENST00000420607
  • ENSP00000409612

Symbol
  • MCAD
  • ACAD1
  • MCADH
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
kinase perturbation
0.93
interacting protein
0.8
transcription factor binding site profile
0.76
transcription factor perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.75   (req: < 5)
Gene RIFs: 38   (req: <= 3)
Antibodies: 407   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.75   (req: >= 5)
Gene RIFs: 38   (req: > 3)
Antibodies: 407   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA (R-HSA-77346)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA
Reactome
Beta oxidation of octanoyl-CoA to hexanoyl-CoA
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA
Beta oxidation of octanoyl-CoA to hexanoyl-CoA
Fatty acid metabolism
Metabolism
Metabolism of lipids
Protein-Protein Interactions (214)
1 – 10 of 214
ACAA2
Tbio
Family: Enzyme
Novelty: 0.02112232
Score: 0.996
Data Source: STRINGDB
HADHB
Tbio
Family: Enzyme
Novelty: 0.01003327
Score: 0.989
Data Source: STRINGDB
EHHADH
Tbio
Novelty: 0.00763197
Score: 0.98
Data Source: STRINGDB
PPARA
Tclin
Family: NR
Novelty: 0.00026802
Score: 0.979
Data Source: STRINGDB
HADHA
Tbio
Novelty: 0.00234785
Score: 0.978
Data Source: STRINGDB
CPT2
Tchem
Family: Enzyme
Novelty: 0.00503221
Score: 0.977
Data Source: STRINGDB
ACAA1
Tbio
Family: Enzyme
Novelty: 0.00482727
Score: 0.975
Data Source: STRINGDB
HADH
Tbio
Family: Enzyme
Novelty: 0.00360431
Score: 0.975
Data Source: STRINGDB
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.969
Data Source: STRINGDB
ALDH6A1
Tbio
Family: Enzyme
Novelty: 0.05651741
Score: 0.96
Data Source: STRINGDB
Publication Statistics
PubMed Score  162.75

PubMed score by year
PubTator Score  566.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKT
1-70
GEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQ
70-140
QKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPD
140-210
PKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKT
210-280
RPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRN
280-350
TYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK
350-420
N
420-421
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYKN