You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRNB1
Acetylcholine receptor subunit beta

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one beta, one gamma, and one delta subunit. This gene encodes the beta subunit of the acetylcholine receptor. The acetylcholine receptor changes conformation upon acetylcholine binding leading to the opening of an ion-conducting channel across the plasma membrane. Mutations in this gene are associated with slow-channel congenital myasthenic syndrome. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306071
  • ENSP00000304290
  • ENSG00000170175
  • ENST00000536404
  • ENSP00000439209
  • ENST00000639692
  • ENSP00000492221
  • ENSG00000283946
  • ENST00000639993
  • ENSP00000491113

Symbol
  • ACHRB
  • CHRNB
  • ACHRB
  • CHRNB
  • CMS1D
  • CMS2A
  • CMS2C
  • SCCMS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
protein domain
0.85
gene perturbation
0.83
small molecule perturbation
0.65
disease perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.18   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 242   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.18   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 242   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 13
Approved Drugs (13)
1 – 10 of 13
tubocurarine
chemical structure image
decamethonium
chemical structure image
rapacuronium
chemical structure image
suxamethonium
chemical structure image
atracurium
chemical structure image
cisatracurium
chemical structure image
pipecuronium
chemical structure image
vecuronium
chemical structure image
dimethyltubocurarinium
chemical structure image
pancuronium
chemical structure image
Gene Ontology Terms (27)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
SynGO
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (75)
1 – 10 of 75
AGTRAP
Tbio
Novelty: 0.02720602
p_int: 0.999999465
p_ni: 5.03e-7
p_wrong: 3.3e-8
Data Source: BioPlex
VWA1
Tbio
Novelty: 0.00145985
p_int: 0.99936728
p_ni: 0.000606336
p_wrong: 0.000026384
Score: 0.156
Data Source: BioPlex,STRINGDB
C1orf43
Tdark
Novelty: 0.23734247
p_int: 0.998908546
p_ni: 0.001091453
p_wrong: 1e-9
Data Source: BioPlex
SARAF
Tbio
Novelty: 0.0643559
p_int: 0.997551544
p_ni: 0.002445108
p_wrong: 0.000003348
Data Source: BioPlex
DNAJC30
Tdark
Novelty: 0.88888889
p_int: 0.996628278
p_ni: 0.003226537
p_wrong: 0.000145185
Data Source: BioPlex
MFAP3
Tdark
Novelty: 1.07142857
p_int: 0.988593897
p_ni: 0.011404184
p_wrong: 0.000001919
Data Source: BioPlex
GHDC
Tbio
Novelty: 0.14562067
p_int: 0.981088806
p_ni: 0.018911192
p_wrong: 2e-9
Data Source: BioPlex
PCNX3
Tdark
Novelty: 1.89473684
p_int: 0.975529105
p_ni: 0.024443298
p_wrong: 0.000027597
Data Source: BioPlex
LEMD2
Tdark
Novelty: 0.1754386
p_int: 0.975287487
p_ni: 0.024712513
Data Source: BioPlex
LRP12
Tbio
Novelty: 0.17314548
p_int: 0.974580099
p_ni: 0.024675448
p_wrong: 0.000744453
Data Source: BioPlex
Publication Statistics
PubMed Score  19.18

PubMed score by year
PubTator Score  30.65

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKD
1-70
EEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVR
70-140
WQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEI
140-210
IHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLS
210-280
IFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIF
280-350
IHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
350-420
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDA
420-490
TYHLPPPDPFP
490-501
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP