You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRM1
Muscarinic acetylcholine receptor M1

Protein Summary
Description
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 1 is involved in mediation of vagally-induced bronchoconstriction and in the acid secretion of the gastrointestinal tract. The gene encoding this receptor is localized to 11q13. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306960
  • ENSP00000306490
  • ENSG00000168539
  • ENST00000543973
  • ENSP00000441188

Symbol
  • M1
  • HM1
  • M1R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
ligand (chemical)
1
chemical
0.9
cell type or tissue
0.85
biological process
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 153.06   (req: < 5)
Gene RIFs: 71   (req: <= 3)
Antibodies: 290   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 153.06   (req: >= 5)
Gene RIFs: 71   (req: > 3)
Antibodies: 290   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 549
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 62
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (36)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (320)
1 – 10 of 320
CCK
Tbio
Novelty: 0.00013779
Score: 0.953
Data Source: STRINGDB
NTSR2
Tchem
Family: GPCR
Novelty: 0.00855606
Score: 0.952
Data Source: STRINGDB
GRM5
Tchem
Family: GPCR
Novelty: 0.00070884
Score: 0.951
Data Source: STRINGDB
ARRB1
Tbio
Novelty: 0.00194842
Score: 0.948
Data Source: STRINGDB
GRK2
Tchem
Family: Kinase
Novelty: 0.00230753
Score: 0.94
Data Source: STRINGDB
PLCB3
Tbio
Family: Enzyme
Novelty: 0.01169145
Score: 0.939
Data Source: STRINGDB
GNA11
Tbio
Novelty: 0.00156526
Score: 0.938
Data Source: STRINGDB
GRM1
Tchem
Family: GPCR
Novelty: 0.0009002
Score: 0.938
Data Source: STRINGDB
GNA15
Tbio
Novelty: 0.0018171
Score: 0.935
Data Source: STRINGDB
GNG3
Tbio
Novelty: 0.16248863
Score: 0.934
Data Source: STRINGDB
Publication Statistics
PubMed Score  153.06

PubMed score by year
PubTator Score  283.38

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACA
1-70
DLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPR
70-140
RAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWR
140-210
IYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEE
210-280
DEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLA
280-350
KRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
350-420
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
420-460
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC