You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DBT
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

Protein Classes
Protein Summary
Description
The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). Within this complex, the catalytic function of this enzyme is to accept, and to transfer to coenzyme A, acyl groups that are generated by the branched-chain alpha-keto acid decarboxylase component. The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spl ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370132
  • ENSP00000359151
  • ENSG00000137992

Symbol
  • BCATE2
  • E2
  • E2B
  • BCATE2
  • BCKADE2
  • BCKAD-E2
  • BCOADC-E2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.96
gene perturbation
0.96
protein domain
0.92
histone modification site profile
0.91
protein complex
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 241.07   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 175   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 241.07   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 175   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Branched-chain amino acid catabolism (R-HSA-70895)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Branched-chain amino acid catabolism
Reactome
Glyoxylate metabolism and glycine degradation
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Branched-chain amino acid catabolism
Glyoxylate metabolism and glycine degradation
Metabolism
Metabolism of amino acids and derivatives
Protein-Protein Interactions (142)
1 – 10 of 142
PPM1K
Tbio
Family: Enzyme
Novelty: 0.04072431
p_int: 0.999999682
p_ni: 1.14e-7
p_wrong: 2.05e-7
Score: 0.97
Data Source: BioPlex,Reactome,STRINGDB
BCKDHB
Tbio
Family: Enzyme
Novelty: 0.03
p_int: 0.999996237
p_ni: 0.000003761
p_wrong: 1e-9
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
DLD
Tbio
Family: Enzyme
Novelty: 0.00268083
p_int: 0.999992693
p_ni: 0.000007305
p_wrong: 2e-9
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
THEM4
Tbio
Family: Enzyme
Novelty: 0.00511448
p_int: 0.999886375
p_ni: 0.000113625
p_wrong: 1e-9
Data Source: BioPlex
RBM5
Tbio
Novelty: 0.02004452
p_int: 0.999618283
p_ni: 0.000381717
Data Source: BioPlex
LIPT1
Tdark
Family: Enzyme
Novelty: 0.0746733
p_int: 0.999579721
p_ni: 0.000420056
p_wrong: 2.23e-7
Score: 0.965
Data Source: BioPlex,STRINGDB
ACAD9
Tbio
Family: Enzyme
Novelty: 0.0452113
p_int: 0.99953058
p_ni: 0.000469415
p_wrong: 5e-9
Score: 0.795
Data Source: BioPlex,STRINGDB
GRPEL2
Tdark
Novelty: 0.77922078
p_int: 0.999278607
p_ni: 0.000721326
p_wrong: 6.7e-8
Score: 0.66
Data Source: BioPlex,STRINGDB
MRRF
Tbio
Novelty: 0.00463476
p_int: 0.997598382
p_ni: 0.002401367
p_wrong: 2.52e-7
Score: 0.228
Data Source: BioPlex,STRINGDB
PPTC7
Tdark
Family: Enzyme
Novelty: 0.76363636
p_int: 0.997586796
p_ni: 0.002413204
Score: 0.238
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  241.07

PubMed score by year
PubTator Score  128.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLS
1-70
DIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIET
70-140
EALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLE
140-210
KQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCD
210-280
EIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDT
280-350
EQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAI
350-420
GALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
420-482
MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK