You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EGR2
E3 SUMO-protein ligase EGR2

Protein Summary
Description
Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. E3 SUMO-protein ligase helping SUMO1 conjugation to its coregulators NAB1 and NAB2, whose sumoylation down-regulates EGR2 own transcriptional activity. The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000242480
  • ENSP00000242480
  • ENSG00000122877
  • ENST00000411732
  • ENSP00000387634
  • ENST00000439032
  • ENSP00000402040

Symbol
  • KROX20
  • CHN1
  • AT591
  • CMT1D
  • CMT4E
  • KROX20
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
molecular function
0.99
PubMedID
0.98
biological process
0.97
virus perturbation
0.94


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 379.21   (req: < 5)
Gene RIFs: 59   (req: <= 3)
Antibodies: 459   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 379.21   (req: >= 5)
Gene RIFs: 59   (req: > 3)
Antibodies: 459   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 34
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (48)
Activation of HOX genes during differentiation (R-HSA-5619507)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of HOX genes during differentiation
Reactome
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Reactome
Developmental Biology
Reactome
Transcriptional regulation of white adipocyte differentiation
Name
Explore in Pharos
Explore in Source
Activation of HOX genes during differentiation
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Developmental Biology
Transcriptional regulation of white adipocyte differentiation
Gene Ontology Terms (38)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (194)
1 – 10 of 194
SNAI1
Tbio
Family: TF
Novelty: 0.00045743
p_int: 0.999998835
p_wrong: 0.000001165
Score: 0.646
Data Source: BioPlex,STRINGDB
JUN
Tchem
Family: TF
Novelty: 0.00013623
Score: 0.981
Data Source: STRINGDB
HOXB1
Tbio
Family: TF
Novelty: 0.00873574
Score: 0.977
Data Source: STRINGDB
EGR3
Tbio
Family: TF
Novelty: 0.00269121
Score: 0.961
Data Source: STRINGDB
MAFB
Tbio
Family: TF
Novelty: 0.00869998
Score: 0.96
Data Source: STRINGDB
HOXA2
Tbio
Family: TF
Novelty: 0.01119905
Score: 0.952
Data Source: STRINGDB
HOXB2
Tbio
Family: TF
Novelty: 0.02193114
Score: 0.95
Data Source: STRINGDB
HOXB3
Tbio
Family: TF
Novelty: 0.02148868
Score: 0.945
Data Source: STRINGDB
CEBPB
Tbio
Family: TF
Novelty: 0.00076161
Score: 0.943
Data Source: STRINGDB
EZH2
Tclin
Family: Epigenetic
Novelty: 0.00057242
Score: 0.929
Data Source: STRINGDB
Publication Statistics
PubMed Score  379.21

PubMed score by year
PubTator Score  239.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRS
1-70
LDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSAS
70-140
PNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPS
140-210
PKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGV
210-280
TGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRR
280-350
FSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH
350-420
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP
420-476
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP