You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
PNMT
Phenylethanolamine N-methyltransferase

Protein Summary
Description
Converts noradrenaline to adrenaline. The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000269582
  • ENSP00000269582
  • ENSG00000141744

Symbol
  • PENT
  • PENT
  • PNMTase
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.76
virus perturbation
0.76
drug
0.7
cell type or tissue
0.69
disease
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 861.84   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 423   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 861.84   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 423   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 71
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (41)
1 – 5 of 41
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
Catecholamine biosynthesis (R-HSA-209905)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Catecholamine biosynthesis
Reactome
Metabolism
Reactome
Metabolism of amine-derived hormones
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Catecholamine biosynthesis
Metabolism
Metabolism of amine-derived hormones
Metabolism of amino acids and derivatives
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (56)
1 – 10 of 56
ESR1
Tclin
Family: NR
Novelty: 0.00008166
p_int: 0.929202421
p_ni: 0.042326228
p_wrong: 0.028471351
Score: 0.555
Data Source: BioPlex,STRINGDB
DBH
Tchem
Family: Enzyme
Novelty: 0.00083795
Score: 0.99
Data Source: STRINGDB
COMT
Tclin
Family: Enzyme
Novelty: 0.00033021
Score: 0.96
Data Source: STRINGDB
MAOA
Tclin
Family: Enzyme
Novelty: 0.00037876
Score: 0.947
Data Source: STRINGDB
MAOB
Tclin
Family: Enzyme
Novelty: 0.00036833
Score: 0.946
Data Source: STRINGDB
LRTOMT
Tbio
Family: Enzyme
Novelty: 0.06650439
Score: 0.904
Data Source: STRINGDB
LRTOMT
Tbio
Novelty: 0.06650439
Score: 0.904
Data Source: STRINGDB
TH
Tclin
Family: Enzyme
Novelty: 0.00030927
Score: 0.89
Data Source: STRINGDB
ZNF347
Tdark
Family: TF
Novelty: 0.02453988
Score: 0.831
Data Source: STRINGDB
EN2
Tbio
Family: TF
Novelty: 0.00435693
Score: 0.753
Data Source: STRINGDB
Publication Statistics
PubMed Score  861.84

PubMed score by year
PubTator Score  330.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV
1-70
SGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECW
70-140
QDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGH
140-210
LLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
210-280
GL
280-282
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL