You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HSPA5
Endoplasmic reticulum chaperone BiP

Protein Summary
Description
Endoplasmic reticulum chaperone that plays a key role in protein folding and quality control in the endoplasmic reticulum lumen (PubMed:2294010, PubMed:23769672, PubMed:23990668, PubMed:28332555). Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10/ERdj5, probably to facilitate the release of DNAJC10/ERdj5 from its substrate (By similarity). Acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR) (PubMed:1550958, PubMed:19538957). In the unstressed endoplasmic reticulum, recruited by DNAJB9/ERdj4 to the luminal region of ERN1/IRE1, leading to disrupt the dimerization of ERN1/IRE1, thereby inactivating ERN1/IRE1 (By similarity). Accumulation of misfolded protein in the endoplasmic reticulum causes release of HSPA5/BiP from ERN1/IRE1, allowing homodimerization and subsequent activation of ERN1/IRE1 (By similarity). Plays an auxiliary role in post-translational transport of small presecretory proteins ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324460
  • ENSP00000324173
  • ENSG00000044574

Symbol
  • GRP78
  • BIP
  • MIF2
  • GRP78
  • HEL-S-89n
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
disease perturbation
1
hub protein
1
interacting protein
1
molecular function
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2012.91   (req: < 5)
Gene RIFs: 403   (req: <= 3)
Antibodies: 1556   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2012.91   (req: >= 5)
Gene RIFs: 403   (req: > 3)
Antibodies: 1556   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 58
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 8
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (16)
1 – 5 of 16
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
ATF6 (ATF6-alpha) activates chaperone genes (R-HSA-381183)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ATF6 (ATF6-alpha) activates chaperone genes
Reactome
ATF6 (ATF6-alpha) activates chaperones
Reactome
Adaptive Immune System
Reactome
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Reactome
Cellular response to heat stress
Name
Explore in Pharos
Explore in Source
ATF6 (ATF6-alpha) activates chaperone genes
ATF6 (ATF6-alpha) activates chaperones
Adaptive Immune System
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Cellular response to heat stress
Gene Ontology Terms (77)
Items per page:
10
1 – 10 of 14
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
AgBase
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (734)
1 – 10 of 734
FUT7
Tchem
Family: Enzyme
Novelty: 0.01563725
p_int: 0.98907021
p_ni: 0.01092979
Data Source: BioPlex
OLFML2B
Tdark
Novelty: 0.29132642
p_int: 0.988169196
p_ni: 0.011830804
Data Source: BioPlex
PATE1
Tbio
Novelty: 0.03158921
p_int: 0.983280882
p_ni: 0.016719118
Data Source: BioPlex
VIT
Tbio
Novelty: 0.20076969
p_int: 0.982697951
p_ni: 0.017302049
Score: 0.194
Data Source: BioPlex,STRINGDB
GAL
Tbio
Novelty: 0.00057698
p_int: 0.982334773
p_ni: 0.017665227
Data Source: BioPlex
SPAG11B
Tbio
Novelty: 0.11942279
p_int: 0.981672421
p_ni: 0.018327579
Data Source: BioPlex
ANGPTL2
Tbio
Novelty: 0.01289757
p_int: 0.980932022
p_ni: 0.019067978
Score: 0.177
Data Source: BioPlex,STRINGDB
PODN
Tbio
Novelty: 0.01764196
p_int: 0.978805073
p_ni: 0.021194927
Data Source: BioPlex
PRSS1
Tclin
Family: Enzyme
Novelty: 0.00182538
p_int: 0.974112244
p_ni: 0.025887756
Score: 0.166
Data Source: BioPlex,STRINGDB
NTF3
Tbio
Novelty: 0.00076486
p_int: 0.973868514
p_ni: 0.026131486
Data Source: BioPlex
Publication Statistics
PubMed Score  2012.91

PubMed score by year
PubTator Score  1622.86

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTP
1-70
EGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTF
70-140
APEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYG
140-210
LDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRK
210-280
DNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSD
280-350
LKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
350-420
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPA
420-490
PRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERID
490-560
TRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPI
560-630
ISKLYGSAGPPPTGEEDTAEKDEL
630-654
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL