You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD8B
T-cell surface glycoprotein CD8 beta chain

Protein Summary
Description
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). A ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000331469
  • ENSP00000331172
  • ENSG00000172116
  • ENST00000349455
  • ENSP00000340592
  • ENST00000390655
  • ENSP00000375070
  • ENST00000393759
  • ENSP00000377356
  • ENST00000393761
  • ENSP00000377358

Symbol
  • CD8B1
  • LY3
  • P37
  • LEU2
  • LYT3
  • CD8B1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.82
gene perturbation
0.67
cell type or tissue
0.66
cellular component
0.65
tissue sample
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 187.02   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 822   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 187.02   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 822   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (35)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Disease
Reactome
HIV Infection
Reactome
Host Interactions of HIV factors
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Disease
HIV Infection
Host Interactions of HIV factors
Immune System
Gene Ontology Terms (13)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (155)
1 – 10 of 155
TMEM11
Tbio
Novelty: 0.00132758
p_int: 0.998882606
p_ni: 0.00111738
p_wrong: 1.5e-8
Data Source: BioPlex
TMEM214
Tdark
Novelty: 1.5
p_int: 0.993858641
p_ni: 0.006141359
Data Source: BioPlex
ANKRD13D
Tdark
p_int: 0.984091696
p_ni: 0.015866485
p_wrong: 0.00004182
Data Source: BioPlex
ATP6V0A2
Tbio
Family: Enzyme
Novelty: 0.0033925
p_int: 0.923926453
p_ni: 0.076073547
Data Source: BioPlex
TMED8
Tdark
p_int: 0.919084595
p_ni: 0.080887386
p_wrong: 0.000028019
Data Source: BioPlex
KLRG2
Tdark
Novelty: 0.77419355
p_int: 0.89862094
p_ni: 0.101378893
p_wrong: 1.67e-7
Data Source: BioPlex
ERGIC2
Tbio
Novelty: 0.12696493
p_int: 0.89464607
p_ni: 0.105331244
p_wrong: 0.000022686
Data Source: BioPlex
CD8A
Tbio
Novelty: 0.00003113
Score: 0.996
Data Source: Reactome,STRINGDB
CD3D
Tclin
Novelty: 0.00372579
Score: 0.987
Data Source: Reactome,STRINGDB
B2M
Tbio
Novelty: 0.00012184
Score: 0.98
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  187.02

PubMed score by year
PubTator Score  117.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFL
1-70
ALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPT
70-140
TAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
140-210
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK