You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
C7
Complement component C7

Protein Summary
Description
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C7 serves as a membrane anchor. This gene encodes a serum glycoprotein that forms a membrane attack complex together with complement components C5b, C6, C8, and C9 as part of the terminal complement pathway of the innate immune system. The protein encoded by this gene contains a cholesterol-dependent cytolysin/membrane attack complex/perforin-like (CDC/MACPF) domain and belongs to a large family of structurally related molecules that form pores involved in host immunity and bacterial pathogenesis. This protein initiates membrane attack complex formation by binding the C5b-C6 subcomplex and inserts into the phospholipid bilayer, serving as a membrane anchor. Mutations in this gene are associated with a rare disorder called C7 deficiency. [provided by RefSeq, Nov 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313164
  • ENSP00000322061
  • ENSG00000112936
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
PubMedID
0.86
microRNA
0.65
cell line
0.62
tissue
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.4   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 255   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.4   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 255   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Complement cascade (R-HSA-166658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complement cascade
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Regulation of Complement cascade
Reactome
Terminal pathway of complement
Name
Explore in Pharos
Explore in Source
Complement cascade
Immune System
Innate Immune System
Regulation of Complement cascade
Terminal pathway of complement
Gene Ontology Terms (9)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (45)
1 – 10 of 45
C5
Tclin
Novelty: 0.0030075
Score: 0.968
Data Source: Reactome,STRINGDB
CFP
Tbio
Novelty: 0.00062861
Score: 0.962
Data Source: STRINGDB
CLU
Tbio
Novelty: 0.00056402
Score: 0.947
Data Source: Reactome,STRINGDB
C6
Tbio
Novelty: 0.01540323
Score: 0.924
Data Source: Reactome,STRINGDB
C8G
Tbio
Novelty: 0.02481402
Score: 0.917
Data Source: Reactome,STRINGDB
VTN
Tbio
Family: TF
Novelty: 0.00057817
Score: 0.917
Data Source: Reactome,STRINGDB
CD59
Tbio
Novelty: 0.00056697
Score: 0.916
Data Source: Reactome,STRINGDB
C9
Tbio
Novelty: 0.00840274
Score: 0.915
Data Source: Reactome,STRINGDB
C8A
Tbio
Novelty: 0.01887053
Score: 0.913
Data Source: Reactome,STRINGDB
C8B
Tbio
Novelty: 0.02916959
Score: 0.907
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  56.40

PubMed score by year
PubTator Score  739.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFET
1-70
QSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELT
70-140
GNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYNSTWSYVKH
140-210
TSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKEL
210-280
SHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSS
280-350
HGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
350-420
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGV
420-490
LVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHC
490-560
FPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIA
560-630
CVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVP
630-700
KCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAE
700-770
KACGACPLWGKCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
770-840
ETQ
840-843
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ