You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CYP2C8
Cytochrome P450 2C8

Protein Summary
Description
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. In the epoxidation of arachidonic acid it generates only 14,15- and 11,12-cis-epoxyeicosatrienoic acids. It is the principal enzyme responsible for the metabolism the anti-cancer drug paclitaxel (taxol). This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, benzo(a)pyrene, 7-ethyoxycoumarin, and the anti-cancer drug taxol. This gene is located within ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371270
  • ENSP00000360317
  • ENSG00000138115
  • ENST00000535898
  • ENSP00000445062

Symbol
  • CPC8
  • CYPIIC8
  • CYP2C8DM
  • MP-12/MP-20
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
chemical
0.97
disease
0.83
biological term
0.82
molecular function
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 373.47   (req: < 5)
Gene RIFs: 121   (req: <= 3)
Antibodies: 200   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 373.47   (req: >= 5)
Gene RIFs: 121   (req: > 3)
Antibodies: 200   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 5
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
phenelzine
chemical structure image
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (30)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Biological oxidations
Reactome
Biosynthesis of DHA-derived SPMs
Reactome
Biosynthesis of maresin-like SPMs
Reactome
Biosynthesis of maresins
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Biological oxidations
Biosynthesis of DHA-derived SPMs
Biosynthesis of maresin-like SPMs
Biosynthesis of maresins
Gene Ontology Terms (24)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (132)
1 – 10 of 132
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
Score: 0.949
Data Source: STRINGDB
EPHX2
Tchem
Family: Enzyme
Novelty: 0.00298106
Score: 0.949
Data Source: STRINGDB
CYP3A4
Tclin
Family: Enzyme
Novelty: 0.00020884
Score: 0.948
Data Source: STRINGDB
CYP4A11
Tbio
Novelty: 0.01325821
Score: 0.944
Data Source: STRINGDB
CYP4F2
Tchem
Family: Enzyme
Novelty: 0.00647783
Score: 0.937
Data Source: STRINGDB
CYP4F3
Tbio
Family: Enzyme
Novelty: 0.01901093
Score: 0.933
Data Source: STRINGDB
PTGS2
Tclin
Family: Enzyme
Novelty: 0.00008134
Score: 0.93
Data Source: STRINGDB
CYP1A2
Tchem
Novelty: 0.00045419
Score: 0.928
Data Source: STRINGDB
CYP4F8
Tbio
Novelty: 0.09383843
Score: 0.926
Data Source: STRINGDB
CYP1A1
Tchem
Novelty: 0.00028982
Score: 0.924
Data Source: STRINGDB
Publication Statistics
PubMed Score  373.47

PubMed score by year
PubTator Score  435.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFG
1-70
MNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRS
70-140
IEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNS
140-210
PWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKS
210-280
EFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA
280-350
VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
350-420
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
420-490
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV