You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RAP2A
Ras-related protein Rap-2a

Protein Summary
Description
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000245304
  • ENSP00000245304
  • ENSG00000125249

Symbol
  • KREV
  • RAP2
  • K-REV
  • RbBP-30
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.95
molecular function
0.91
transcription factor binding site profile
0.9
biological process
0.84
virus perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 130.99   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 134   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 130.99   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 134   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
PathwayCommons: panther
Integrin signalling pathway
PathwayCommons: pid
CXCR4-mediated signaling events
PathwayCommons: netpath
BCR
Name
Explore in Pharos
Explore in Source
Integrin signalling pathway
CXCR4-mediated signaling events
BCR
Gene Ontology Terms (21)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Protein-Protein Interactions (104)
1 – 10 of 104
RABGGTB
Tbio
Family: Enzyme
Novelty: 0.13346044
p_int: 0.993818531
p_ni: 0.006181469
Score: 0.263
Data Source: BioPlex,STRINGDB
SDC1
Tbio
Novelty: 0.0006457
p_int: 0.981317274
p_ni: 0.018682726
Score: 0.181
Data Source: BioPlex,STRINGDB
TMEM185A
Tdark
Novelty: 0.03619125
p_int: 0.976166976
p_ni: 0.023833024
Data Source: BioPlex
CYP2S1
Tbio
Novelty: 0.04038753
p_int: 0.921455792
p_ni: 0.078543881
p_wrong: 3.27e-7
Score: 0.168
Data Source: BioPlex,STRINGDB
MARVELD2
Tbio
Novelty: 0.01661397
p_int: 0.91484625
p_ni: 0.085153721
p_wrong: 2.8e-8
Score: 0.188
Data Source: BioPlex,STRINGDB
S1PR1
Tclin
Family: GPCR
Novelty: 0.00202384
p_int: 0.851972424
p_ni: 0.148025897
p_wrong: 0.000001678
Score: 0.181
Data Source: BioPlex,STRINGDB
KIFAP3
Tbio
Novelty: 0.03856985
p_int: 0.797593071
p_ni: 0.202406639
p_wrong: 2.91e-7
Score: 0.175
Data Source: BioPlex,STRINGDB
NCSTN
Tbio
Novelty: 0.00628726
p_int: 0.784875915
p_ni: 0.215124079
p_wrong: 6e-9
Score: 0.169
Data Source: BioPlex,STRINGDB
VDAC3
Tbio
Novelty: 0.01448609
p_int: 0.751432182
p_ni: 0.248567266
p_wrong: 5.52e-7
Score: 0.222
Data Source: BioPlex,STRINGDB
CXCL12
Tbio
Novelty: 0.00031121
Score: 0.915
Data Source: STRINGDB
Publication Statistics
PubMed Score  130.99

PubMed score by year
PubTator Score  74.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
1-70
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC
70-140
PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ
140-183
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ