You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FDX1
Adrenodoxin, mitochondrial

Protein Summary
Description
Essential for the synthesis of various steroid hormones (PubMed:20547883, PubMed:21636783). Participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis (PubMed:20547883, PubMed:21636783). Transfers electrons from adrenodoxin reductase to CYP11A1, a cytochrome P450 that catalyzes cholesterol side-chain cleavage (PubMed:20547883, PubMed:21636783). Does not form a ternary complex with adrenodoxin reductase and CYP11A1 but shuttles between the two enzymes to transfer electrons (By similarity). This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260270
  • ENSP00000260270
  • ENSG00000137714

Symbol
  • ADX
  • ADX
  • FDX
  • LOH11CR1D
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
pathway
0.91
transcription factor perturbation
0.91
virus perturbation
0.85
disease perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 686   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 88   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 686   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 88   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)
Reactome
Disease
Reactome
Diseases of metabolism
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cytochrome P450 - arranged by substrate type
Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)
Disease
Diseases of metabolism
Protein-Protein Interactions (92)
1 – 10 of 92
FDXR
Tbio
Family: Enzyme
Novelty: 0.00218519
Score: 0.999
Data Source: Reactome,STRINGDB
CYP11A1
Tclin
Family: Enzyme
Novelty: 0.0011106
Score: 0.998
Data Source: Reactome,STRINGDB
FXN
Tbio
Novelty: 0.00088838
Score: 0.978
Data Source: STRINGDB
LYRM4
Tbio
Novelty: 0.04832863
Score: 0.977
Data Source: STRINGDB
STAR
Tbio
Novelty: 0.00143063
Score: 0.97
Data Source: STRINGDB
ISCU
Tbio
Novelty: 0.00546455
Score: 0.956
Data Source: STRINGDB
FDX2
Tdark
Novelty: 0.13023256
Score: 0.949
Data Source: Reactome,STRINGDB
HSCB
Tbio
Novelty: 0.02066624
Score: 0.926
Data Source: STRINGDB
NFS1
Tbio
Family: Enzyme
Novelty: 0.01736003
Score: 0.885
Data Source: STRINGDB
ISCA1
Tbio
Novelty: 0.01855615
Score: 0.842
Data Source: STRINGDB
Publication Statistics
PubMed Score  686.00

PubMed score by year
PubTator Score  40.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH
1-70
FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL
70-140
AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
140-184
MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS