You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
GLI4
Zinc finger protein GLI4

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340042
  • ENSP00000345024
  • ENSG00000250571
  • ENST00000523522
  • ENSP00000430987

Symbol
  • HKR4
  • HKR4
  • ZNF928
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.68
tissue sample
0.57
transcription factor
0.52
cell line
0.51
tissue
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.82   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 170   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.82   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 170   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (15)
1 – 10 of 15
VTN
Tbio
Family: TF
Novelty: 0.00057817
p_int: 0.999998906
p_ni: 1.5e-8
p_wrong: 0.000001079
Score: 0.229
Data Source: BioPlex,STRINGDB
RETN
Tbio
Novelty: 0.00076494
p_int: 0.999994028
p_ni: 7.07e-7
p_wrong: 0.000005265
Score: 0.359
Data Source: BioPlex,STRINGDB
LRRC14
Tdark
Novelty: 1.125
Score: 0.585
Data Source: STRINGDB
NRAS
Tchem
Family: Enzyme
Novelty: 0.00085585
Score: 0.521
Data Source: STRINGDB
LRRC24
Tdark
Novelty: 9
Score: 0.505
Data Source: STRINGDB
WDR97
Tdark
Score: 0.491
Data Source: STRINGDB
STK36
Tdark
Family: Kinase
Novelty: 0.30550841
Score: 0.478
Data Source: STRINGDB
DXO
Tbio
Family: Enzyme
Novelty: 0.01961014
Score: 0.473
Data Source: STRINGDB
MYCL
Tbio
Family: TF
Novelty: 0.00183456
Score: 0.469
Data Source: STRINGDB
MMTAG2
Tdark
Novelty: 0.75
Score: 0.457
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.82

PubMed score by year
PubTator Score  2.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRD
1-70
TFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPR
70-140
GAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKP
140-210
YACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSS
210-280
NLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKP
280-350
FACGACGKAFGQSSQLIQHQRVHYRE
350-376
MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE