You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TMIGD3
Transmembrane domain-containing protein TMIGD3

Protein Summary
Description
Isoform 1: Plays a suppressive role in osteosarcoma malignancy by inhibiting NF-kappa-B activity (PubMed:27886186). This gene encodes a transmembrane and immunoglobulin domain-containing protein. Alternative splicing results in multiple transcript variants, one of which shares its 5' terminal exon with that of the overlapping adenosine A3 receptor gene (GeneID:140), thus resulting in a fusion product. [provided by RefSeq, Nov 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369716
  • ENSP00000358730
  • ENSG00000121933
  • ENST00000369717
  • ENSP00000358731

Symbol
  • AD026
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1139.29   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 88   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1139.29   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 88   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 66
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (307)
1 – 10 of 307
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
Score: 0.968
Data Source: STRINGDB
P2RY13
Tchem
Family: GPCR
Novelty: 0.03338395
Score: 0.966
Data Source: STRINGDB
P2RY4
Tchem
Family: GPCR
Novelty: 0.01341753
Score: 0.956
Data Source: STRINGDB
P2RY14
Tchem
Family: GPCR
Novelty: 0.02096508
Score: 0.955
Data Source: STRINGDB
ADRA2A
Tclin
Family: GPCR
Novelty: 0.00092475
Score: 0.953
Data Source: STRINGDB
OPRL1
Tchem
Family: GPCR
Novelty: 0.00075372
Score: 0.953
Data Source: STRINGDB
CNR1
Tclin
Family: GPCR
Novelty: 0.00017618
Score: 0.952
Data Source: STRINGDB
OPRM1
Tclin
Family: GPCR
Novelty: 0.00035782
Score: 0.95
Data Source: STRINGDB
OPRD1
Tclin
Family: GPCR
Novelty: 0.001182
Score: 0.95
Data Source: STRINGDB
OPRK1
Tclin
Family: GPCR
Novelty: 0.00087396
Score: 0.949
Data Source: STRINGDB
Publication Statistics
PubMed Score  1139.29

PubMed score by year
PubTator Score  0.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMWLFILLSLALI
1-70
SDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVT
70-140
MSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSR
140-210
TSILIICILITGLGIISVISHLTKRRRSQRNRRVGNTLKPFSRVLTPKEMAPTEQM
210-266
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMWLFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQRNRRVGNTLKPFSRVLTPKEMAPTEQM