You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ADORA3
Adenosine receptor A3

Protein Summary
Description
Isoform 2: Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase (PubMed:8234299). Isoform 1: Plays a suppressive role in osteosarcoma malignancy by inhibiting NF-kappa-B activity (PubMed:27886186). This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobuli ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000241356
  • ENSP00000241356
  • ENSG00000282608

Symbol
  • A3AR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (chemical)
1
biological process
0.95
gene perturbation
0.65
chemical
0.64
disease
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1139.29   (req: < 5)
Gene RIFs: 57   (req: <= 3)
Antibodies: 116   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1139.29   (req: >= 5)
Gene RIFs: 57   (req: > 3)
Antibodies: 116   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1746
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 23
Active Ligands (1746)
1 – 10 of 1746
CHEMBL39,CHEMBL535832
chemical structure image
CHEMBL464859
chemical structure image
CHEMBL56
chemical structure image
CHEMBL119709
chemical structure image
CHEMBL431733
chemical structure image
CHEMBL76897
chemical structure image
CHEMBL16687
chemical structure image
CHEMBL113142
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
Adenosine P1 receptors (R-HSA-417973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adenosine P1 receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Adenosine P1 receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (313)
1 – 10 of 313
TBC1D9B
Tdark
Novelty: 2.44186047
p_int: 0.99930851
p_ni: 0.00069149
Score: 0.227
Data Source: BioPlex,STRINGDB
ATP12A
Tchem
Family: Transporter
Novelty: 0.00013675
p_int: 0.969060768
p_ni: 0.030932701
p_wrong: 0.000006532
Score: 0.178
Data Source: BioPlex,STRINGDB
TMEM11
Tbio
Novelty: 0.00132758
p_int: 0.967365865
p_ni: 0.015772435
p_wrong: 0.016861699
Score: 0.208
Data Source: BioPlex,STRINGDB
IPO9
Tbio
Novelty: 0.06055386
p_int: 0.931299544
p_ni: 0.068700456
Score: 0.193
Data Source: BioPlex,STRINGDB
CAND2
Tbio
Novelty: 0.00222158
p_int: 0.878132634
p_ni: 0.121867366
Score: 0.165
Data Source: BioPlex,STRINGDB
IPO11
Tbio
Novelty: 0.13870542
p_int: 0.76819606
p_ni: 0.231803898
p_wrong: 4.1e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
Score: 0.968
Data Source: STRINGDB
P2RY13
Tchem
Family: GPCR
Novelty: 0.03338395
Score: 0.966
Data Source: STRINGDB
P2RY4
Tchem
Family: GPCR
Novelty: 0.01341753
Score: 0.956
Data Source: STRINGDB
P2RY14
Tchem
Family: GPCR
Novelty: 0.02096508
Score: 0.955
Data Source: STRINGDB
Publication Statistics
PubMed Score  1139.29

PubMed score by year
PubTator Score  255.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAI
1-70
VVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFL
70-140
VGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSL
140-210
NLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPI
210-280
VYAYKIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE
280-318
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE