Protein Classes
Protein Summary
Isoform 2: Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase (PubMed:8234299). Isoform 1: Plays a suppressive role in osteosarcoma malignancy by inhibiting NF-kappa-B activity (PubMed:27886186). This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobuli ...more
- ENST00000241356
- ENSP00000241356
- ENSG00000282608
- A3AR
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
ligand (chemical) | 1 | ||
biological process | 0.95 | ||
gene perturbation | 0.65 | ||
chemical | 0.64 | ||
disease | 0.62 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1139.29 (req: < 5)
Gene RIFs: 57 (req: <= 3)
Antibodies: 116 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1139.29 (req: >= 5)
Gene RIFs: 57 (req: > 3)
Antibodies: 116 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 10
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 1746
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 23
Approved Drugs (23)
1 – 10 of 23
Active Ligands (1746)
1 – 10 of 1746
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (22)
Reactome (8)
KEGG (3)
PathwayCommons (2)
WikiPathways (9)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 8
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Adenosine P1 receptors | ||||
Reactome | Class A/1 (Rhodopsin-like receptors) | ||||
Reactome | G alpha (i) signalling events | ||||
Reactome | GPCR downstream signalling | ||||
Reactome | GPCR ligand binding | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Adenosine P1 receptors | ||||
Class A/1 (Rhodopsin-like receptors) | ||||
G alpha (i) signalling events | ||||
GPCR downstream signalling | ||||
GPCR ligand binding | ||||
Gene Ontology Terms (12)
Functions (1)
Components (2)
Processes (9)
Items per page:
10
1 – 1 of 1
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (313)
1 – 10 of 313
TBC1D9B
Novelty: 2.44186047
p_int: 0.99930851
p_ni: 0.00069149
Score: 0.227
Data Source: BioPlex,STRINGDB
ATP12A
Family: Transporter
Novelty: 0.00013675
p_int: 0.969060768
p_ni: 0.030932701
p_wrong: 0.000006532
Score: 0.178
Data Source: BioPlex,STRINGDB
TMEM11
Novelty: 0.00132758
p_int: 0.967365865
p_ni: 0.015772435
p_wrong: 0.016861699
Score: 0.208
Data Source: BioPlex,STRINGDB
IPO9
Novelty: 0.06055386
p_int: 0.931299544
p_ni: 0.068700456
Score: 0.193
Data Source: BioPlex,STRINGDB
CAND2
Novelty: 0.00222158
p_int: 0.878132634
p_ni: 0.121867366
Score: 0.165
Data Source: BioPlex,STRINGDB
IPO11
Novelty: 0.13870542
p_int: 0.76819606
p_ni: 0.231803898
p_wrong: 4.1e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
P2RY12
Family: GPCR
Novelty: 0.00057146
Score: 0.968
Data Source: STRINGDB
P2RY13
Family: GPCR
Novelty: 0.03338395
Score: 0.966
Data Source: STRINGDB
P2RY4
Family: GPCR
Novelty: 0.01341753
Score: 0.956
Data Source: STRINGDB
P2RY14
Family: GPCR
Novelty: 0.02096508
Score: 0.955
Data Source: STRINGDB
Publication Statistics
PubMed Score 1139.29
PubMed score by year
PubTator Score 255.01
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAI
1-70
VVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFL
70-140
VGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSL
140-210
NLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPI
210-280
VYAYKIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE
280-318
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE
Find similar targets by: