You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SULT1A3
Sulfotransferase 1A3

Protein Summary
Description
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Read-through transcription exists between this gene and the upstream SLX1A (SLX1 structure-specific endonuclease subunit homolog A) gene that encodes a protein containin ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000338971
  • ENSP00000343645
  • ENSG00000261052
  • ENST00000395138
  • ENSP00000378570
  • ENST00000563322
  • ENSP00000454518

Symbol
  • STM
  • STM
  • HAST
  • HAST3
  • M-PST
  • ST1A3
  • ST1A4
  • ST1A5
  • TL-PST
  • ST1A3/ST1A4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
0.77
tissue
0.6
tissue sample
0.6
cell line
0.5
pathway
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 293.64   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 181   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 293.64   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 181   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cytosolic sulfonation of small molecules
Reactome
IRE1alpha activates chaperones
Reactome
Metabolism
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cytosolic sulfonation of small molecules
IRE1alpha activates chaperones
Metabolism
Metabolism of proteins
Protein-Protein Interactions (32)
1 – 10 of 32
SULT1A2
Tbio
Family: Enzyme
Novelty: 0.01305806
p_int: 0.999999993
p_ni: 6e-9
p_wrong: 1e-9
Score: 0.868
Data Source: BioPlex,STRINGDB
SULT1A1
Tbio
Family: Enzyme
Novelty: 0.00274079
p_int: 0.99999998
p_ni: 2e-8
Score: 0.934
Data Source: BioPlex,STRINGDB
MPPED2
Tbio
Family: Enzyme
Novelty: 0.12686905
p_int: 0.987699154
p_ni: 0.012300846
Score: 0.393
Data Source: BioPlex,STRINGDB
SULT4A1
Tbio
Family: Enzyme
Novelty: 0.01224754
p_int: 0.962489206
p_ni: 0.037510794
Score: 0.845
Data Source: BioPlex,STRINGDB
SULT1C2
Tbio
Family: Enzyme
Novelty: 0.0385947
p_int: 0.905795058
p_ni: 0.094204942
Score: 0.879
Data Source: BioPlex,STRINGDB
TTC1
Tbio
Novelty: 0.02687059
p_int: 0.777117227
p_ni: 0.222882772
p_wrong: 1e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
THBD
Tbio
Novelty: 0.00046438
Score: 0.84
Data Source: STRINGDB
SULT1A4
Tdark
Family: Enzyme
Novelty: 59
Score: 0.819
Data Source: STRINGDB
GOT1
Tbio
Family: Enzyme
Novelty: 0.00607491
Score: 0.74
Data Source: STRINGDB
VWF
Tbio
Novelty: 0.00010911
Score: 0.635
Data Source: STRINGDB
Publication Statistics
PubMed Score  293.64

PubMed score by year
PubTator Score  791.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKC
1-70
NRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYY
70-140
HFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEF
140-210
VGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADY
210-280
AEKMAGCSLSFRSEL
280-295
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL