You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF728
Zinc finger protein 728

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000594710
  • ENSP00000471593
  • ENSG00000269067
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.59
protein domain
0.58
interacting protein
0.53
tissue sample
0.48
protein complex
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (2)
1 – 2 of 2
SNAPC5
Tdark
Novelty: 1.40939597
Score: 0.491
Data Source: STRINGDB
DMRT1
Tbio
Family: TF
Novelty: 0.00466598
Score: 0.421
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGKEPWNMKRHEL
1-70
VKEPPVICSHFAQDLWPEQGREDSFQKVILRRYEKCGHENLQLKIGCTNVDECKVHKKGYNKLNQSLTTT
70-140
QSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVRSFCMLSHLSQHKRIYTRENSYKSEEHGKAF
140-210
NWSSALTYKRIHTGEKPCKCEECGKAFSKFSILTKHKVIHTGEKHYKCEECGKAFTRSSSLIEHKRSHAG
210-280
EKPYKCEECGKAFSKASTLTAHKTIHAGEKPYKCEECGKAFNRSSNLMEHKRIHTGEKPCKCEECGKAFG
280-350
NFSTLTKHKVIHTGEKPYKCEECGKAFSWPSSLTEHKRIHAGDKPYKCEECGKTFKWSSTLTKHKIIHTG
350-420
EKPYKCEECGKAFTTFSSLTKHKVIHTGEKHYKCEECGKVFSWSSSLTTHKAIHAGEKLYKCEECGKAFK
420-490
WSSNLMEHKRIHTGEKPYKCEECGKAFSKVANLTKHKVIHTGEKQYKCEECGKAFIWSSRLSEHKRIHTG
490-560
EKPYKCEECGKAFSWVSVLNKHKKIHAGKKFYKCEECGKDFNQSSHLTTHKRIHTGGKTLQM
560-622
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGKEPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYEKCGHENLQLKIGCTNVDECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVRSFCMLSHLSQHKRIYTRENSYKSEEHGKAFNWSSALTYKRIHTGEKPCKCEECGKAFSKFSILTKHKVIHTGEKHYKCEECGKAFTRSSSLIEHKRSHAGEKPYKCEECGKAFSKASTLTAHKTIHAGEKPYKCEECGKAFNRSSNLMEHKRIHTGEKPCKCEECGKAFGNFSTLTKHKVIHTGEKPYKCEECGKAFSWPSSLTEHKRIHAGDKPYKCEECGKTFKWSSTLTKHKIIHTGEKPYKCEECGKAFTTFSSLTKHKVIHTGEKHYKCEECGKVFSWSSSLTTHKAIHAGEKLYKCEECGKAFKWSSNLMEHKRIHTGEKPYKCEECGKAFSKVANLTKHKVIHTGEKQYKCEECGKAFIWSSRLSEHKRIHTGEKPYKCEECGKAFSWVSVLNKHKKIHAGKKFYKCEECGKDFNQSSHLTTHKRIHTGGKTLQM