You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SAA1
Serum amyloid A-1 protein

Protein Summary
Description
Major acute phase protein. This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Feb 2016]
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.98
biological term
0.95
cell type or tissue
0.92
biological process
0.91
pathway
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1372.47   (req: < 5)
Gene RIFs: 186   (req: <= 3)
Antibodies: 539   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1372.47   (req: >= 5)
Gene RIFs: 186   (req: > 3)
Antibodies: 539   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (44)
Advanced glycosylation endproduct receptor signaling (R-HSA-879415)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 41
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Advanced glycosylation endproduct receptor signaling
Reactome
Amyloid fiber formation
Reactome
Binding and Uptake of Ligands by Scavenger Receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Cytokine Signaling in Immune system
Name
Explore in Pharos
Explore in Source
Advanced glycosylation endproduct receptor signaling
Amyloid fiber formation
Binding and Uptake of Ligands by Scavenger Receptors
Class A/1 (Rhodopsin-like receptors)
Cytokine Signaling in Immune system
Protein-Protein Interactions (446)
1 – 10 of 446
APCS
Tchem
Novelty: 0.00181352
Score: 0.957
Data Source: STRINGDB
CXCL8
Tchem
Novelty: 0.00009183
Score: 0.955
Data Source: STRINGDB
APOA1
Tbio
Novelty: 0.0001431
Score: 0.953
Data Source: STRINGDB
FPR2
Tchem
Family: GPCR
Novelty: 0.00286277
Score: 0.953
Data Source: STRINGDB
FPR1
Tchem
Family: GPCR
Novelty: 0.00150161
Score: 0.951
Data Source: STRINGDB
CXCL1
Tbio
Novelty: 0.00066136
Score: 0.944
Data Source: STRINGDB
S100A12
Tbio
Novelty: 0.00324527
Score: 0.942
Data Source: STRINGDB
CXCL10
Tchem
Novelty: 0.00051044
Score: 0.941
Data Source: STRINGDB
CCL13
Tbio
Novelty: 0.00932733
Score: 0.941
Data Source: STRINGDB
CXCR3
Tchem
Family: GPCR
Novelty: 0.00129022
Score: 0.939
Data Source: STRINGDB
Publication Statistics
PubMed Score  1372.47

PubMed score by year
PubTator Score  382.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
1-70
WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
70-122
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY