You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
IGLC1
Immunoglobulin lambda constant 1

Protein Summary
Description
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affin ...more
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.74
tissue
0.65
interacting protein
0.59
tissue sample
0.49
cell line
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 207.43   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 207.43   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 26
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Reactome
Binding and Uptake of Ligands by Scavenger Receptors
Reactome
CD22 mediated BCR regulation
Reactome
Cell surface interactions at the vascular wall
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Binding and Uptake of Ligands by Scavenger Receptors
CD22 mediated BCR regulation
Cell surface interactions at the vascular wall
Protein-Protein Interactions (162)
1 – 10 of 162
CD79A
Tbio
Novelty: 0.00192293
Score: 0.973
Data Source: STRINGDB
JCHAIN
Tbio
Novelty: 0.00213004
Score: 0.966
Data Source: STRINGDB
CD19
Tclin
Novelty: 0.00031194
Score: 0.963
Data Source: STRINGDB
CD79B
Tclin
Novelty: 0.00265318
Score: 0.962
Data Source: STRINGDB
IGHV4-38-2
Tdark
Novelty: 0.00022506
Score: 0.962
Data Source: STRINGDB
IGHV3-11
Tdark
Novelty: 0.18808777
Score: 0.955
Data Source: STRINGDB
BLNK
Tbio
Novelty: 0.00324006
Score: 0.95
Data Source: STRINGDB
HCK
Tclin
Family: Kinase
Novelty: 0.00027617
Score: 0.948
Data Source: STRINGDB
BTK
Tclin
Family: Kinase
Novelty: 0.000673
Score: 0.948
Data Source: STRINGDB
SYK
Tclin
Family: Kinase
Novelty: 0.00067612
Score: 0.943
Data Source: STRINGDB
Publication Statistics
PubMed Score  207.43

PubMed score by year
PubTator Score  1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
1-70
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
70-106
GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS