You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
UBTFL1
Upstream-binding factor 1-like protein 1

Protein Summary
Description
Essential for proliferation of the inner cell mass and trophectodermal cells in peri-implantation development. UBTFL1 is a preimplantation-specific gene and is involved in early development, implantation, and embryonic stem (ES) cell derivation (summary by Yamada et al., 2010 [PubMed 19915186]).[supplied by OMIM, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000530464
  • ENSP00000485108
  • ENSG00000255009

Symbol
  • C11orf27
  • HMGPI
  • C11orf27
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.84
cell line
0.73
protein complex
0.4
cellular component
0.34
biological term
0.33


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.94   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 22   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.94   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 22   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (24)
1 – 10 of 24
BDP1
Tbio
Novelty: 0.00576319
Score: 0.749
Data Source: STRINGDB
EMP2
Tbio
Novelty: 0.00474286
Score: 0.655
Data Source: STRINGDB
ZSCAN4
Tbio
Family: TF
Novelty: 0.03276791
Score: 0.628
Data Source: STRINGDB
CDX2
Tbio
Family: TF
Novelty: 0.00108779
Score: 0.609
Data Source: STRINGDB
LEUTX
Tdark
Family: TF
Novelty: 0.38834951
Score: 0.577
Data Source: STRINGDB
OR2T2
Tdark
Family: oGPCR
Novelty: 6
Score: 0.573
Data Source: STRINGDB
OR4C3
Tdark
Family: oGPCR
Score: 0.57
Data Source: STRINGDB
TRIM43
Tdark
Novelty: 0.70588235
Score: 0.513
Data Source: STRINGDB
ZNF595
Tdark
Novelty: 2.68623025
Score: 0.507
Data Source: STRINGDB
GTF2IRD1
Tbio
Family: TF
Novelty: 0.01581239
Score: 0.493
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.94

PubMed score by year
PubTator Score  1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKWLEISCNLRKF
1-70
GTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPGMRSQELTKILSKKYRE
70-140
LPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKKSSVSKRTQNKVQKKFQKNIEEVRSLPKTDR
140-210
FFKKVKFHGEPQKPPMNGYHKFHQDSWSSKEMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQY
210-280
KVKLDLWLKTLSPENYAAYKESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDS
280-350
SQTIWVNCHVSMEPEENRKKDREKEESSNSSDCSSGEEIEVDV
350-393
MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKWLEISCNLRKFGTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPGMRSQELTKILSKKYRELPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKKSSVSKRTQNKVQKKFQKNIEEVRSLPKTDRFFKKVKFHGEPQKPPMNGYHKFHQDSWSSKEMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQYKVKLDLWLKTLSPENYAAYKESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDSSQTIWVNCHVSMEPEENRKKDREKEESSNSSDCSSGEEIEVDV