You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ATXN1L
Ataxin-1-like

Protein Summary
Description
Chromatin-binding factor that repress Notch signaling in the absence of Notch intracellular domain by acting as a CBF1 corepressor. Binds to the HEY promoter and might assist, along with NCOR2, RBPJ-mediated repression (PubMed:21475249). Can suppress ATXN1 cytotoxicity in spinocerebellar ataxia type 1 (SCA1). In concert with CIC and ATXN1, involved in brain development (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000427980
  • ENSP00000415822
  • ENSG00000224470

Symbol
  • BOAT
  • BOAT1
  • BOAT
  • BOAT1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.86
biological process
0.68
cell type or tissue
0.65
interacting protein
0.6
transcription factor
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.86   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 81   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.86   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 81   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (14)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (32)
1 – 10 of 32
CLASRP
Tbio
Novelty: 0.00099222
p_int: 0.999999969
p_ni: 1.9e-8
p_wrong: 1.2e-8
Score: 0.233
Data Source: BioPlex,STRINGDB
ZBTB18
Tbio
Family: TF
Novelty: 0.06172849
p_int: 0.999999923
p_ni: 5.5e-8
p_wrong: 2.2e-8
Score: 0.269
Data Source: BioPlex,STRINGDB
CIC
Tbio
Family: TF
Novelty: 0.01217744
Score: 0.945
Data Source: STRINGDB
RBM17
Tbio
Novelty: 0.05783133
Score: 0.767
Data Source: STRINGDB
ZNF821
Tdark
Family: TF
Novelty: 0.83333333
Score: 0.742
Data Source: STRINGDB
BBX
Tbio
Family: TF
Novelty: 0.02256768
Score: 0.734
Data Source: STRINGDB
TXNL4B
Tbio
Novelty: 0.00158517
Score: 0.607
Data Source: STRINGDB
PCP2
Tdark
Novelty: 0.06252326
Score: 0.601
Data Source: STRINGDB
PQBP1
Tbio
Novelty: 0.0195288
Score: 0.579
Data Source: STRINGDB
HBP1
Tbio
Family: TF
Novelty: 0.07252633
Score: 0.576
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.86

PubMed score by year
PubTator Score  116.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEA
1-70
ITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHPGIHYPPLHYAQLPSTSLQFI
70-140
GSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQAPSPAHSFNKAPSATSPSGQ
140-210
LPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQSALEAAAANGGQRPRERNLV
210-280
RRESEALDSPNSKGEGQGLVPVVECVVDGQLFSGSQTPRVEVAAPAHRGTPDTDLEVQRVVGALASQDYR
280-350
VVAAQRKEEPSPLNLSHHTPDHQGEGRGSARNPAELAEKSQARGFYPQSHQEPVKHRPLPKAMVVANGNL
350-420
VPTGTDSGLLPVGSEILVASSLDVQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQT
420-490
QDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRT
490-560
TQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPSQLGPPRERPERTVLGSRELCDSEGKSQPAGE
560-630
GSRVVEPSQPESGAQACWPAPSFQRYSMQGEEARAALLRPSFIPQEVKLSIEGRSNAGK
630-689
MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGARVSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHPGIHYPPLHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASLLAEGATPPPQAPSPAHSFNKAPSATSPSGQLPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQSALEAAAANGGQRPRERNLVRRESEALDSPNSKGEGQGLVPVVECVVDGQLFSGSQTPRVEVAAPAHRGTPDTDLEVQRVVGALASQDYRVVAAQRKEEPSPLNLSHHTPDHQGEGRGSARNPAELAEKSQARGFYPQSHQEPVKHRPLPKAMVVANGNLVPTGTDSGLLPVGSEILVASSLDVQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTTQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPSQLGPPRERPERTVLGSRELCDSEGKSQPAGEGSRVVEPSQPESGAQACWPAPSFQRYSMQGEEARAALLRPSFIPQEVKLSIEGRSNAGK