You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WEE2
Wee1-like protein kinase 2

Protein Summary
Description
Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits CDK1/CDC2 and acts as a key regulator of meiosis during both prophase I and metaphase II (PubMed:29606300). Required to maintain meiotic arrest in oocytes during the germinal vesicle (GV) stage, a long period of quiescence at dictyate prophase I, by phosphorylating CDK1 at 'Tyr-15', leading to inhibit CDK1 activity and prevent meiotic reentry. Also required for metaphase II exit during egg activation by phosphorylating CDK1 at 'Tyr-15', to ensure exit from meiosis in oocytes and promote pronuclear formation (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000397541
  • ENSP00000380675
  • ENSG00000214102
  • ENST00000574659
  • ENSP00000459392
  • ENSG00000263042

Symbol
  • WEE1B
  • OOMD5
  • WEE1B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
biological process
0.75
protein domain
0.73
microRNA
0.51
biological term
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.72   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 101   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.72   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 101   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (16)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (84)
1 – 10 of 84
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.919
Data Source: STRINGDB
CDC25B
Tchem
Family: Enzyme
Novelty: 0.0044301
Score: 0.838
Data Source: STRINGDB
WEE1
Tchem
Family: Kinase
Novelty: 0.00181917
Score: 0.81
Data Source: STRINGDB
CDC25A
Tchem
Family: Enzyme
Novelty: 0.00322177
Score: 0.726
Data Source: STRINGDB
CDC25C
Tchem
Family: Enzyme
Novelty: 0.00287182
Score: 0.709
Data Source: STRINGDB
FBXO43
Tbio
Novelty: 0.03375075
Score: 0.686
Data Source: STRINGDB
CCNB1
Tchem
Novelty: 0.00068627
Score: 0.66
Data Source: STRINGDB
FZR1
Tbio
Novelty: 0.01409033
Score: 0.65
Data Source: STRINGDB
BTG4
Tbio
Novelty: 0.07290121
Score: 0.645
Data Source: STRINGDB
CDC20
Tbio
Novelty: 0.00237728
Score: 0.619
Data Source: STRINGDB
Publication Statistics
PubMed Score  16.72

PubMed score by year
PubTator Score  5.97

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSS
1-70
EKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRLVISPTGKLPSRGPKHLKLTP
70-140
APLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDLEEAGPEEGKGGLPAKRCVLRETNMASRYEK
140-210
EFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWA
210-280
EDDHMIIQNEYCNGGSLQAAISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHK
280-350
MQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFAL
350-420
GLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAALARNTVLRPSL
420-490
GKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTGSRSTKRLVGGKSARSSSFTS
490-560
GEREPLH
560-567
MDDKDIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSSEKDKESPDQILRTPVSHPLKCPETPAQPDSRSKLLPSDSPSTPKTMLSRLVISPTGKLPSRGPKHLKLTPAPLKDEMTSLALVNINPFTPESYKKLFLQSGGKRKIRGDLEEAGPEEGKGGLPAKRCVLRETNMASRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWAEDDHMIIQNEYCNGGSLQAAISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFLANEILQEDYRHLPKADIFALGLTIAVAAGAESLPTNGAAWHHIRKGNFPDVPQELSESFSSLLKNMIQPDAEQRPSAAALARNTVLRPSLGKTEELQQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTGSRSTKRLVGGKSARSSSFTSGEREPLH