You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TPM1
Tropomyosin alpha-1 chain

Protein Summary
Description
Binds to actin filaments in muscle and non-muscle cells (PubMed:23170982). Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction (PubMed:23170982). Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dep ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267996
  • ENSP00000267996
  • ENSG00000140416
  • ENST00000288398
  • ENSP00000288398
  • ENST00000334895
  • ENSP00000334624
  • ENST00000358278
  • ENSP00000351022
  • ENST00000403994
  • ENSP00000385107
  • ENST00000559397
  • ENSP00000452879
  • ENST00000559556
  • ENSP00000453941
  • ENST00000561266
  • ENSP00000453955

Symbol
  • C15orf13
  • TMSA
  • CMH3
  • TMSA
  • CMD1Y
  • LVNC9
  • C15orf13
  • HEL-S-265
  • HTM-alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
PubMedID
0.93
interacting protein
0.85
kinase perturbation
0.84
small molecule perturbation
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 275.01   (req: < 5)
Gene RIFs: 97   (req: <= 3)
Antibodies: 301   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 275.01   (req: >= 5)
Gene RIFs: 97   (req: > 3)
Antibodies: 301   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Smooth Muscle Contraction
Reactome
Striated Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Smooth Muscle Contraction
Striated Muscle Contraction
Gene Ontology Terms (38)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (198)
1 – 10 of 198
TPM2
Tbio
Novelty: 0.00510926
p_int: 0.999999996
p_ni: 4e-9
Score: 0.983
Data Source: BioPlex,STRINGDB
KLHL21
Tbio
Novelty: 0.51282051
p_int: 0.999987986
p_ni: 0.000012008
p_wrong: 6e-9
Score: 0.213
Data Source: BioPlex,STRINGDB
KXD1
Tdark
Novelty: 0.22340426
p_int: 0.999984834
p_ni: 0.000014383
p_wrong: 7.83e-7
Score: 0.768
Data Source: BioPlex,STRINGDB
EXOC4
Tbio
Novelty: 0.02000189
p_int: 0.999884817
p_ni: 0.000115183
Score: 0.276
Data Source: BioPlex,STRINGDB
DLG5
Tbio
Novelty: 0.01693739
p_int: 0.999377534
p_ni: 0.000050854
p_wrong: 0.000571612
Score: 0.353
Data Source: BioPlex,STRINGDB
RUFY2
Tbio
Novelty: 0.76564417
p_int: 0.998963136
p_ni: 0.001036864
Score: 0.213
Data Source: BioPlex,STRINGDB
SCLT1
Tdark
Novelty: 0.23413981
p_int: 0.998773183
p_ni: 0.001216397
p_wrong: 0.00001042
Score: 0.213
Data Source: BioPlex,STRINGDB
CCDC102A
Tdark
Novelty: 8
p_int: 0.998700256
p_ni: 0.001299744
Data Source: BioPlex
MAD1L1
Tbio
Novelty: 0.06114575
p_int: 0.996832336
p_ni: 0.003167664
Score: 0.332
Data Source: BioPlex,STRINGDB
CROCC
Tbio
Novelty: 0.04047137
p_int: 0.991825333
p_ni: 0.008174666
Score: 0.213
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  275.01

PubMed score by year
PubTator Score  217.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK
1-70
LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK
70-140
MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ
140-210
AEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND
210-280
MTSI
280-284
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI