You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GNAO1
Guanine nucleotide-binding protein G(o) subunit alpha

Protein Summary
Description
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14. The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262493
  • ENSP00000262493
  • ENSG00000087258
  • ENST00000262494
  • ENSP00000262494
  • ENST00000638705
  • ENSP00000491223

Symbol
  • GNAO
  • NEDIM
  • EIEE17
  • HLA-DQB1
  • G-ALPHA-o
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
disease perturbation
0.97
interacting protein
0.77
microRNA
0.74
PubMedID
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 158.39   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 239   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 158.39   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 239   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (64)
Beta-catenin independent WNT signaling (R-HSA-3858494)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta-catenin independent WNT signaling
Reactome
Ca2+ pathway
Reactome
Chaperonin-mediated protein folding
Reactome
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
Reactome
G alpha (i) signalling events
Name
Explore in Pharos
Explore in Source
Beta-catenin independent WNT signaling
Ca2+ pathway
Chaperonin-mediated protein folding
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
G alpha (i) signalling events
Gene Ontology Terms (30)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (324)
1 – 10 of 324
GNAI1
Tbio
Novelty: 0.12575547
p_int: 0.999999979
p_ni: 2e-8
Score: 0.957
Data Source: BioPlex,STRINGDB
GNAI3
Tbio
Novelty: 0.03936457
p_int: 0.999999749
p_ni: 2.5e-7
Score: 0.938
Data Source: BioPlex,STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
p_int: 0.999999531
p_ni: 4.63e-7
p_wrong: 6e-9
Score: 0.952
Data Source: BioPlex,STRINGDB
GNG3
Tbio
Novelty: 0.16248863
p_int: 0.999979135
p_ni: 0.000020865
Score: 0.993
Data Source: BioPlex,STRINGDB
GNG2
Tbio
Novelty: 0.08273543
p_int: 0.998302339
p_ni: 0.001697661
Score: 0.99
Data Source: BioPlex,Reactome,STRINGDB
RIC8A
Tbio
Novelty: 0.01968858
p_int: 0.997792235
p_ni: 0.002203926
p_wrong: 0.000003839
Score: 0.784
Data Source: BioPlex,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.974642241
p_ni: 0.025357759
Data Source: BioPlex
PI4K2A
Tbio
Family: Kinase
Novelty: 0.00759288
p_int: 0.943177172
p_ni: 0.056822822
p_wrong: 6e-9
Data Source: BioPlex
GJB7
Tdark
Novelty: 0.28301887
p_int: 0.93556089
p_ni: 0.064439105
p_wrong: 5e-9
Data Source: BioPlex
FBXL22
Tdark
Novelty: 2.88157895
p_int: 0.931404592
p_ni: 0.068595408
Data Source: BioPlex
Publication Statistics
PubMed Score  158.39

PubMed score by year
PubTator Score  99.22

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK
1-70
PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC
70-140
FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK
140-210
KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIK
210-280
KSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRG
280-350
CGLY
350-354
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY