You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HBQ1
Hemoglobin subunit theta-1

Protein Summary
Description
Theta-globin mRNA is found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. The theta-1 gene may be expressed very early in embryonic life, perhaps sometime before 5 weeks. Theta-1 is a member of the human alpha-globin gene cluster that involves five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-2 -pseudoalpha-1 - alpha-2 - alpha-1 - theta-1 - 3'. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000199708
  • ENSP00000199708
  • ENSG00000086506

Symbol
  • HBQ
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
cell type or tissue
0.57
co-expressed gene
0.57
molecular function
0.56
transcription factor binding site profile
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 118.14   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 138   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 118.14   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 138   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (11)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (21)
1 – 10 of 21
HBE1
Tbio
Novelty: 0.000322
Score: 0.952
Data Source: STRINGDB
HBB
Tbio
Novelty: 0.00039916
Score: 0.95
Data Source: STRINGDB
AHSP
Tbio
Novelty: 0.00903598
Score: 0.949
Data Source: STRINGDB
HBA1
Tclin
Novelty: 0.00071922
Score: 0.941
Data Source: STRINGDB
HBZ
Tbio
Novelty: 0.00392792
Score: 0.919
Data Source: STRINGDB
HBG2
Tbio
Novelty: 0.0203014
Score: 0.885
Data Source: STRINGDB
HBD
Tbio
Novelty: 0.00175538
Score: 0.869
Data Source: STRINGDB
ALAS2
Tbio
Family: Enzyme
Novelty: 0.00595008
Score: 0.814
Data Source: STRINGDB
EPB42
Tbio
Family: Enzyme
Novelty: 0.09881965
Score: 0.77
Data Source: STRINGDB
LUC7L
Tbio
Novelty: 0.08359873
Score: 0.755
Data Source: STRINGDB
Publication Statistics
PubMed Score  118.14

PubMed score by year
PubTator Score  12.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLA
1-70
VERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSE
70-140
YR
140-142
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR