You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRM5
Muscarinic acetylcholine receptor M5

Protein Summary
Description
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover. The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000383263
  • ENSP00000372750
  • ENSG00000184984
  • ENST00000557872
  • ENSP00000453745

Symbol
  • HM5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
0.99
ligand (chemical)
0.96
biological process
0.75
molecular function
0.7
trait
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.2   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 218   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.2   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 218   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 124
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 38
Pathways (19)
Amine ligand-binding receptors (R-HSA-375280)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amine ligand-binding receptors
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Amine ligand-binding receptors
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (20)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (181)
1 – 10 of 181
GRM5
Tchem
Family: GPCR
Novelty: 0.00070884
Score: 0.945
Data Source: STRINGDB
GRK2
Tchem
Family: Kinase
Novelty: 0.00230753
Score: 0.942
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.92
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.919
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.919
Data Source: STRINGDB
GNA11
Tbio
Novelty: 0.00156526
Score: 0.918
Data Source: STRINGDB
GNB5
Tbio
Novelty: 0.01077999
Score: 0.918
Data Source: STRINGDB
GNG13
Tbio
Novelty: 0.14784205
Score: 0.916
Data Source: STRINGDB
BDKRB2
Tclin
Family: GPCR
Novelty: 0.00504032
Score: 0.915
Data Source: STRINGDB
ADRA1D
Tclin
Family: GPCR
Novelty: 0.00053743
Score: 0.915
Data Source: STRINGDB
Publication Statistics
PubMed Score  23.20

PubMed score by year
PubTator Score  7.48

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLL
1-70
SLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRA
70-140
KRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMT
140-210
ILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTST
210-280
TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAE
280-350
TEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
350-420
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTV
420-490
NPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
490-532
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP