You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NFIC
Nuclear factor 1 C-type

Protein Summary
Description
Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. The protein encoded by this gene belongs to the CTF/NF-I family. These are dimeric DNA-binding proteins, and function as cellular transcription factors and as replication factors for adenovirus DNA replication. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000341919
  • ENSP00000342194
  • ENSG00000141905
  • ENST00000395111
  • ENSP00000378543
  • ENST00000443272
  • ENSP00000396843
  • ENST00000586919
  • ENSP00000465177
  • ENST00000589123
  • ENSP00000465655
  • ENST00000590282
  • ENSP00000466647

Symbol
  • NFI
  • CTF
  • NFI
  • CTF5
  • NF-I
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
ligand (protein) perturbation
0.83
interacting protein
0.81
molecular function
0.81
transcription factor binding site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 392.61   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 270   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 392.61   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 270   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
RNA Polymerase III Abortive And Retractive Initiation
Reactome
RNA Polymerase III Transcription
Reactome
RNA Polymerase III Transcription Termination
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
RNA Polymerase III Abortive And Retractive Initiation
RNA Polymerase III Transcription
RNA Polymerase III Transcription Termination
Gene Ontology Terms (11)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Protein-Protein Interactions (90)
1 – 10 of 90
TH
Tclin
Family: Enzyme
Novelty: 0.00030927
p_int: 0.999999396
p_ni: 3.71e-7
p_wrong: 2.32e-7
Score: 0.281
Data Source: BioPlex,STRINGDB
NFIB
Tbio
Family: TF
Novelty: 0.00861711
p_int: 0.997310668
p_ni: 5.4e-8
p_wrong: 0.002689278
Score: 0.514
Data Source: BioPlex,STRINGDB
CDC5L
Tbio
Family: TF
Novelty: 0.00617757
Score: 0.98
Data Source: STRINGDB
ZNF274
Tbio
Family: TF
Novelty: 0.03182578
Score: 0.922
Data Source: STRINGDB
APH1B
Tbio
Family: Enzyme
Novelty: 0.06372483
Score: 0.917
Data Source: STRINGDB
APH1A
Tbio
Family: Enzyme
Novelty: 0.01327464
Score: 0.909
Data Source: STRINGDB
PSEN1
Tchem
Family: Enzyme
Novelty: 0.00034716
Score: 0.906
Data Source: STRINGDB
NCSTN
Tbio
Novelty: 0.00628726
Score: 0.906
Data Source: STRINGDB
BDNF
Tbio
Novelty: 0.00008738
Score: 0.905
Data Source: STRINGDB
PSENEN
Tchem
Family: Enzyme
Novelty: 0.00152532
Score: 0.905
Data Source: STRINGDB
Publication Statistics
PubMed Score  392.61

PubMed score by year
PubTator Score  257.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYSSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEVKQ
1-70
KWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKG
70-140
IPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPIT
140-210
LDTTDFQESFVTSGVFSVTELIQVSRTPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSK
210-280
RHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFT
280-350
QHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQ
350-420
PGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG
420-490
LGPRDPAGIYQAQSWYLG
490-508
MYSSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKPEVKQKWASRLLAKLRKDIRPECREDFVLSITGKKAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAQCGHPVLCVQPHHIGVAVKELDLYLAYFVRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQVSRTPVVTGTGPNFSLGELQGHLAYDLNPASTGLRRTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVGLGPRDPAGIYQAQSWYLG