You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SP1
Transcription factor Sp1

Protein Summary
Description
Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR-alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays an essential role in the regulation of FE65 gene expression. In complex with ATF7IP, maintains telomerase activity in cancer cells by inducing TERT and TERC gene expression. Isoform 3 is a stronger activator of transcription than isoform 1. Positively regulates the transcription of the core clock component ARNTL/BMAL1 (PubMed:10391891, PubMed:11371615, PubMed:11904305, PubMed:1459311 ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000327443
  • ENSP00000329357
  • ENSG00000185591
  • ENST00000426431
  • ENSP00000404263

Symbol
  • TSFP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
1
molecular function
1
biological term
0.99
chemical
0.99
transcription factor binding site profile
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1037.05   (req: < 5)
Gene RIFs: 747   (req: <= 3)
Antibodies: 963   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1037.05   (req: >= 5)
Gene RIFs: 747   (req: > 3)
Antibodies: 963   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 38
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (125)
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 23
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of gene expression by SREBF (SREBP)
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
ESR-mediated signaling
Name
Explore in Pharos
Explore in Source
Activation of gene expression by SREBF (SREBP)
Cellular Senescence
Cellular responses to external stimuli
Cellular responses to stress
ESR-mediated signaling
Gene Ontology Terms (44)
Items per page:
10
1 – 10 of 21
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
BHF-UCL
Protein-Protein Interactions (417)
1 – 10 of 417
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.987
Data Source: STRINGDB
ESR1
Tclin
Family: NR
Novelty: 0.00008166
Score: 0.982
Data Source: STRINGDB
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.982
Data Source: STRINGDB
MAPK8
Tchem
Family: Kinase
Novelty: 0.00013952
Score: 0.979
Data Source: STRINGDB
CDKN1A
Tbio
Family: Enzyme
Novelty: 0.00038005
Score: 0.976
Data Source: STRINGDB
JUN
Tchem
Family: TF
Novelty: 0.00013623
Score: 0.975
Data Source: STRINGDB
HDAC1
Tclin
Family: Epigenetic
Novelty: 0.00083441
Score: 0.972
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.972
Data Source: STRINGDB
TBP
Tbio
Novelty: 0.00051191
Score: 0.968
Data Source: STRINGDB
MAPK3
Tchem
Family: Kinase
Novelty: 0.0001911
Score: 0.967
Data Source: STRINGDB
Publication Statistics
PubMed Score  1037.05

PubMed score by year
PubTator Score  3251.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSR
1-70
IESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNR
70-140
TVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGA
140-210
NQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPS
210-280
SQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTN
280-350
SQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL
350-420
SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGV
420-490
SLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGD
490-560
HGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHI
560-630
QGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDH
630-700
LSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVM
700-770
QVADLQSINISGNGF
770-785
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF