You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TPM2
Tropomyosin beta chain

Protein Summary
Description
Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments. The non-muscle isoform may have a role in agonist-mediated receptor internalization. This gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease, nemaline myopathy and distal arthrogryposis syndromes. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000360958
  • ENSP00000354219
  • ENSG00000198467
  • ENST00000378292
  • ENSP00000367542
  • ENST00000378300
  • ENSP00000367550
  • ENST00000645482
  • ENSP00000496494

Symbol
  • TMSB
  • DA1
  • DA2B
  • NEM4
  • TMSB
  • AMCD1
  • HEL-S-273
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
PubMedID
0.93
small molecule perturbation
0.71
gene perturbation
0.7
transcription factor
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 191.54   (req: < 5)
Gene RIFs: 44   (req: <= 3)
Antibodies: 285   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 191.54   (req: >= 5)
Gene RIFs: 44   (req: > 3)
Antibodies: 285   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Smooth Muscle Contraction
Reactome
Striated Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Smooth Muscle Contraction
Striated Muscle Contraction
Gene Ontology Terms (14)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (227)
1 – 10 of 227
TPM1
Tbio
Novelty: 0.00363188
p_int: 0.999999996
p_ni: 4e-9
Score: 0.983
Data Source: BioPlex,STRINGDB
SYCE1
Tbio
Novelty: 0.07934297
p_int: 0.999869463
p_ni: 0.000130536
p_wrong: 1e-9
Data Source: BioPlex
EBNA1BP2
Tbio
Novelty: 0.02554881
p_int: 0.999516323
p_ni: 0.000350523
p_wrong: 0.000133155
Data Source: BioPlex
ABTB2
Tdark
Novelty: 3.6
p_int: 0.998577626
p_ni: 0.001422366
p_wrong: 9e-9
Data Source: BioPlex
FAM9C
Tdark
Novelty: 1.42857143
p_int: 0.997318366
p_ni: 0.002681521
p_wrong: 1.13e-7
Data Source: BioPlex
RSPH6A
Tdark
Novelty: 0.07169275
p_int: 0.994308381
p_ni: 0.005691518
p_wrong: 1.01e-7
Data Source: BioPlex
SLC25A48
Tdark
Family: Transporter
Novelty: 2.57142857
p_int: 0.994010195
p_ni: 0.005989804
p_wrong: 1e-9
Score: 0.181
Data Source: BioPlex,STRINGDB
TIMM44
Tbio
Family: Enzyme
Novelty: 0.02745397
p_int: 0.992822398
p_ni: 0.007177601
p_wrong: 1e-9
Score: 0.188
Data Source: BioPlex,STRINGDB
PCGF2
Tbio
Novelty: 0.02620321
p_int: 0.990210142
p_ni: 0.009789858
Score: 0.16
Data Source: BioPlex,STRINGDB
CIART
Tbio
Novelty: 0.00335302
p_int: 0.989012036
p_ni: 0.010987964
Score: 0.28
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  191.54

PubMed score by year
PubTator Score  83.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEK
1-70
LEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK
70-140
MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQ
140-210
ADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALND
210-280
ITSL
280-284
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL