You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HNRNPC
Heterogeneous nuclear ribonucleoproteins C1/C2

Protein Summary
Description
Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles (PubMed:8264621). Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules (PubMed:12509468, PubMed:16010978, PubMed:7567451, PubMed:8264621). Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides (PubMed:8264621). May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing (PubMed:25719671). This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus an ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000420743
  • ENSP00000404848
  • ENSG00000092199
  • ENST00000430246
  • ENSP00000442816
  • ENST00000553300
  • ENSP00000450544
  • ENST00000554455
  • ENSP00000451291
  • ENST00000554969
  • ENSP00000450725
  • ENST00000555883
  • ENSP00000450629
  • ENST00000556628
  • ENSP00000451652
  • ENST00000556897
  • ENSP00000451176
  • ENST00000557201
  • ENSP00000452276

Symbol
  • HNRPC
  • C1
  • C2
  • HNRNP
  • HNRPC
  • SNRPC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
drug perturbation
1
hub protein
1
interacting protein
1
ligand (protein) perturbation
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 426.39   (req: < 5)
Gene RIFs: 43   (req: <= 3)
Antibodies: 430   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 426.39   (req: >= 5)
Gene RIFs: 43   (req: > 3)
Antibodies: 430   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
SUMO E3 ligases SUMOylate target proteins
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Metabolism of proteins
Post-translational protein modification
Processing of Capped Intron-Containing Pre-mRNA
SUMO E3 ligases SUMOylate target proteins
Gene Ontology Terms (28)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (571)
1 – 10 of 571
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.988945952
p_ni: 0.011054048
Score: 0.96
Data Source: BioPlex,STRINGDB
ILF2
Tbio
Novelty: 0.02058216
p_int: 0.946699083
p_ni: 0.053300917
Score: 0.974
Data Source: BioPlex,STRINGDB
GSPT2
Tbio
Family: Enzyme
Novelty: 0.12428326
p_int: 0.908309639
p_ni: 0.091690361
Score: 0.435
Data Source: BioPlex,STRINGDB
MTMR7
Tdark
Family: Enzyme
Novelty: 0.3486924
p_int: 0.857309764
p_ni: 0.142690236
Score: 0.23
Data Source: BioPlex,STRINGDB
APOBEC3D
Tbio
Novelty: 0.02451843
p_int: 0.83796576
p_ni: 0.16203424
Data Source: BioPlex
FBXW11
Tbio
Novelty: 0.14703388
p_int: 0.837910032
p_ni: 0.162089968
Data Source: BioPlex
NKAPD1
Tdark
Novelty: 2.25
p_int: 0.827882717
p_ni: 0.172117283
Data Source: BioPlex
RBM47
Tbio
Novelty: 0.0509482
p_int: 0.793681836
p_ni: 0.206318164
Score: 0.288
Data Source: BioPlex,STRINGDB
MAP7
Tbio
Novelty: 0.02738196
p_int: 0.762066957
p_ni: 0.237933043
Data Source: BioPlex
LARP4B
Tbio
Novelty: 0.153294
p_int: 0.750932798
p_ni: 0.249067202
Data Source: BioPlex
Publication Statistics
PubMed Score  426.39

PubMed score by year
PubTator Score  2424.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGE
1-70
DGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYP
70-140
ARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSL
140-210
LENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQL
210-280
ELIKDDEKEAEEGEDDRDSANGEDDS
280-306
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS