You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HSP90AA1
Heat shock protein HSP 90-alpha

Protein Summary
Description
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity which is essential for its chaperone activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function (PubMed:11274138, PubMed:15577939, PubMed:15937123, PubMed:27353360, PubMed:29127155). Engages with a range of client protein classes via its interaction with various co-chaperone proteins or complexes, that act as adapters, simultaneously able to interact with the specific client and the central chaperone itself (PubMed:29127155). Recruitment of ATP and co-chaperone followed by client protein forms a functional chaperone. After the completion of the chap ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000216281
  • ENSP00000216281
  • ENSG00000080824
  • ENST00000334701
  • ENSP00000335153

Symbol
  • HSP90A
  • HSPC1
  • HSPCA
  • EL52
  • HSPN
  • LAP2
  • HSP86
  • HSPC1
  • HSPCA
  • Hsp89
  • Hsp90
  • LAP-2
  • HSP89A
  • HSP90A
  • HSP90N
  • Hsp103
  • HSPCAL1
  • HSPCAL4
  • HEL-S-65p
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
hub protein
1
interacting protein
1
molecular function
1
disease perturbation
0.99


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5029.85   (req: < 5)
Gene RIFs: 395   (req: <= 3)
Antibodies: 1647   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5029.85   (req: >= 5)
Gene RIFs: 395   (req: > 3)
Antibodies: 1647   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 61
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 807
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (286)
1 – 5 of 286
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (351)
AURKA Activation by TPX2 (R-HSA-8854518)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 75
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AURKA Activation by TPX2
Reactome
Anchoring of the basal body to the plasma membrane
Reactome
Attenuation phase
Reactome
Autophagy
Reactome
Axon guidance
Name
Explore in Pharos
Explore in Source
AURKA Activation by TPX2
Anchoring of the basal body to the plasma membrane
Attenuation phase
Autophagy
Axon guidance
Gene Ontology Terms (81)
Items per page:
10
1 – 10 of 20
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (1131)
1 – 10 of 1131
HSP90AB1
Tchem
Novelty: 0.01466977
p_int: 0.999660179
p_ni: 0.000339821
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
CDK9
Tchem
Family: Kinase
Novelty: 0.00248764
p_int: 0.999611252
p_ni: 0.000388748
Score: 0.607
Data Source: BioPlex,STRINGDB
STK11
Tchem
Family: Kinase
Novelty: 0.00094968
p_int: 0.999239487
p_ni: 0.000760513
Score: 0.959
Data Source: BioPlex,STRINGDB
RPS6KA4
Tchem
Family: Kinase
Novelty: 0.06941721
p_int: 0.997527817
p_ni: 0.002472183
Data Source: BioPlex
PINK1
Tbio
Family: Kinase
Novelty: 0.00128084
p_int: 0.997043726
p_ni: 0.002956274
Score: 0.855
Data Source: BioPlex,STRINGDB
CDK7
Tchem
Family: Kinase
Novelty: 0.00400101
p_int: 0.996888042
p_ni: 0.003111958
Score: 0.38
Data Source: BioPlex,STRINGDB
CDK4
Tclin
Family: Kinase
Novelty: 0.00051528
p_int: 0.99601604
p_ni: 0.00398396
Score: 0.907
Data Source: BioPlex,STRINGDB
CDK3
Tchem
Family: Kinase
Novelty: 0.04846001
p_int: 0.994959633
p_ni: 0.005040367
Score: 0.6
Data Source: BioPlex,STRINGDB
SMYD3
Tchem
Family: Epigenetic
Novelty: 0.01227968
p_int: 0.994797126
p_ni: 0.005202874
Score: 0.709
Data Source: BioPlex,STRINGDB
CDK13
Tchem
Family: Kinase
Novelty: 0.04248849
p_int: 0.994216901
p_ni: 0.005783099
Score: 0.309
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  5029.85

PubMed score by year
PubTator Score  2994.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL
1-70
DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS
70-140
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH
140-210
SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI
210-280
KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD
280-350
LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
350-420
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH
420-490
IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK
490-560
QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA
560-630
KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE
630-700
DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD
700-732
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD