You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRNG
Acetylcholine receptor subunit gamma

Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis.[provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389492
  • ENSP00000374143
  • ENSG00000196811
  • ENST00000389494
  • ENSP00000374145

Symbol
  • ACHRG
  • ACHRG
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.88
protein domain
0.85
cell type or tissue
0.83
gene perturbation
0.76
phenotype
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.85   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 132   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.85   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 132   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Pathways (9)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly sodium permeable acetylcholine nicotinic receptors
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Postsynaptic nicotinic acetylcholine receptors
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly sodium permeable acetylcholine nicotinic receptors
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Postsynaptic nicotinic acetylcholine receptors
Protein-Protein Interactions (65)
1 – 10 of 65
ACTL6B
Tbio
Novelty: 0.09956074
p_int: 0.931400868
p_ni: 0.06541401
p_wrong: 0.003185121
Score: 0.507
Data Source: BioPlex,STRINGDB
CHRND
Tclin
Family: IC
Novelty: 0.04863852
Score: 0.979
Data Source: STRINGDB
RAPSN
Tbio
Novelty: 0.00693723
Score: 0.969
Data Source: STRINGDB
CHRNB1
Tclin
Family: IC
Novelty: 0.05359833
Score: 0.963
Data Source: STRINGDB
MUSK
Tchem
Family: Kinase
Novelty: 0.00204037
Score: 0.956
Data Source: STRINGDB
AGRN
Tbio
Novelty: 0.0018427
Score: 0.938
Data Source: STRINGDB
CHRNA4
Tclin
Family: IC
Novelty: 0.00260286
Score: 0.91
Data Source: STRINGDB
CHRNA3
Tclin
Family: IC
Novelty: 0.00918226
Score: 0.91
Data Source: Reactome,STRINGDB
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
Score: 0.909
Data Source: Reactome,STRINGDB
CHRNB2
Tclin
Family: IC
Novelty: 0.02119739
Score: 0.908
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.85

PubMed score by year
PubTator Score  16.46

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREE
1-70
ALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYW
70-140
LPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQH
140-210
RPAKMLLDPAAPAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINV
210-280
LLAQTVFLFLVAKKVPETSQAVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRL
280-350
LPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGP
350-420
ELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAMLSLFICGTAG
420-490
IFLMAHYNRVPALPFPGDPRPYLPSPD
490-517
MHGGQGPLLLLLLLAVCLGAQGRNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLPAKAGGQKCTVAINVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLLVVTILIVVNAVVVLNVSLRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDRVCFLAMLSLFICGTAGIFLMAHYNRVPALPFPGDPRPYLPSPD