You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
C8B
Complement component C8 beta chain

Protein Summary
Description
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. This gene encodes one of the three subunits of the complement component 8 (C8) protein. C8 is composed of equimolar amounts of alpha, beta and gamma subunits, which are encoded by three separate genes. C8 is one component of the membrane attack complex, which mediates cell lysis, and it initiates membrane penetration of the complex. This protein mediates the interaction of C8 with the C5b-7 membrane attack complex precursor. In humans deficiency of this protein is associated with increased risk of meningococcal infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371237
  • ENSP00000360281
  • ENSG00000021852

Symbol
  • C82
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
gene perturbation
0.81
disease
0.47
cell line
0.46
tissue
0.44


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.47   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 186   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.47   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 186   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Complement cascade (R-HSA-166658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complement cascade
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Regulation of Complement cascade
Reactome
Terminal pathway of complement
Name
Explore in Pharos
Explore in Source
Complement cascade
Immune System
Innate Immune System
Regulation of Complement cascade
Terminal pathway of complement
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (107)
1 – 10 of 107
DPY19L3
Tbio
Family: Enzyme
Novelty: 0.42105263
p_int: 0.999999989
p_ni: 1.1e-8
Data Source: BioPlex
PAPSS2
Tbio
Family: Enzyme
Novelty: 0.02465931
p_int: 0.999989677
p_ni: 0.00001032
p_wrong: 3e-9
Data Source: BioPlex
KDM1B
Tbio
Family: Epigenetic
Novelty: 0.03022771
p_int: 0.998865688
p_ni: 0.001134289
p_wrong: 2.4e-8
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.810564824
p_ni: 0.189435176
Data Source: BioPlex
C8A
Tbio
Novelty: 0.01887053
Score: 0.997
Data Source: Reactome,STRINGDB
C8G
Tbio
Novelty: 0.02481402
Score: 0.995
Data Source: Reactome,STRINGDB
C5
Tclin
Novelty: 0.0030075
Score: 0.978
Data Source: Reactome,STRINGDB
C9
Tbio
Novelty: 0.00840274
Score: 0.956
Data Source: Reactome,STRINGDB
CLU
Tbio
Novelty: 0.00056402
Score: 0.949
Data Source: Reactome,STRINGDB
CD59
Tbio
Novelty: 0.00056697
Score: 0.941
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  35.47

PubMed score by year
PubTator Score  127.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW
1-70
SSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLC
70-140
NGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRF
140-210
RKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIR
210-280
RTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL
280-350
GGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
350-420
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMK
420-490
QALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGR
490-560
RKTRQRQCNNPPPQNGGSPCSGPASETLDCS
560-591
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS