You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
C8A
Complement component C8 alpha chain

Protein Summary
Description
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C8A inserts into the target membrane, but does not form pores by itself. C8 is a component of the complement system and contains three polypeptides, alpha, beta and gamma. This gene encodes the alpha subunit of C8. C8 participates in the formation of the membrane attack complex (MAC). The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause complement C8 alpha-gamma deficiency. [provided by RefSeq, Nov 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361249
  • ENSP00000354458
  • ENSG00000157131
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
cell type or tissue
0.89
cell line
0.7
PubMedID
0.63
gene perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.23   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 45   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.23   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 45   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (33)
Complement cascade (R-HSA-166658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complement cascade
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Regulation of Complement cascade
Reactome
Terminal pathway of complement
Name
Explore in Pharos
Explore in Source
Complement cascade
Immune System
Innate Immune System
Regulation of Complement cascade
Terminal pathway of complement
Gene Ontology Terms (14)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (141)
1 – 10 of 141
MESD
Tbio
Novelty: 0.04043386
p_int: 0.999942288
p_ni: 0.000057712
Data Source: BioPlex
TAF7
Tbio
Novelty: 0.06908096
p_int: 0.99128154
p_ni: 0.008571334
p_wrong: 0.000147126
Data Source: BioPlex
CMIP
Tbio
Novelty: 0.02011849
p_int: 0.986433649
p_ni: 0.013446662
p_wrong: 0.000119689
Data Source: BioPlex
MMP14
Tchem
Family: Enzyme
Novelty: 0.00092685
p_int: 0.983676656
p_ni: 0.016323258
p_wrong: 8.6e-8
Data Source: BioPlex
ZMYM2
Tbio
Novelty: 0.02496059
p_int: 0.983343222
p_ni: 0.016656778
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.960008365
p_ni: 0.039991635
Data Source: BioPlex
TWSG1
Tbio
Novelty: 0.00313886
p_int: 0.923497102
p_ni: 0.076055219
p_wrong: 0.000447678
Data Source: BioPlex
FBLN1
Tbio
Novelty: 0.00999502
p_int: 0.847832054
p_ni: 0.152167946
Score: 0.173
Data Source: BioPlex,STRINGDB
EEF1A1
Tchem
Novelty: 0.00084049
p_int: 0.841353813
p_ni: 0.158646187
Data Source: BioPlex
FBXO2
Tbio
Novelty: 0.03751923
p_int: 0.837854416
p_ni: 0.162145577
p_wrong: 6e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  51.23

PubMed score by year
PubTator Score  73.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFG
1-70
GTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDC
70-140
SQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPY
140-210
NFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELN
210-280
KYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGI
280-350
YEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
350-420
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQY
420-490
LMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRR
490-560
ECDNPAPQNGGASCPGRKVQTQAC
560-584
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC