You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PROS1
Vitamin K-dependent protein S

Protein Summary
Description
Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis. This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Oct 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000348974
  • ENSP00000330021
  • ENSG00000184500
  • ENST00000394236
  • ENSP00000377783

Symbol
  • PROS
  • PSA
  • PROS
  • PS21
  • PS22
  • PS23
  • PS24
  • PS25
  • THPH5
  • THPH6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
transcription factor perturbation
0.94
kinase perturbation
0.88
PubMedID
0.82
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2719.55   (req: < 5)
Gene RIFs: 159   (req: <= 3)
Antibodies: 416   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2719.55   (req: >= 5)
Gene RIFs: 159   (req: > 3)
Antibodies: 416   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (63)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
Common Pathway of Fibrin Clot Formation
Reactome
Complement cascade
Reactome
Formation of Fibrin Clot (Clotting Cascade)
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
Common Pathway of Fibrin Clot Formation
Complement cascade
Formation of Fibrin Clot (Clotting Cascade)
Gamma carboxylation, hypusine formation and arylsulfatase activation
Gene Ontology Terms (17)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (118)
1 – 10 of 118
C4BPB
Tbio
Novelty: 0.12609905
p_int: 0.999314189
p_ni: 0.000685811
Score: 0.962
Data Source: BioPlex,Reactome,STRINGDB
LY86
Tbio
Novelty: 0.00136228
p_int: 0.978077808
p_ni: 0.021922167
p_wrong: 2.5e-8
Data Source: BioPlex
TFPI2
Tbio
Novelty: 0.00485132
p_int: 0.961833083
p_ni: 0.038166896
p_wrong: 2.2e-8
Score: 0.15
Data Source: BioPlex,STRINGDB
RLN1
Tbio
Novelty: 0.05712331
p_int: 0.908865341
p_ni: 0.09113332
p_wrong: 0.000001339
Data Source: BioPlex
LYZL2
Tdark
Family: Enzyme
Novelty: 1.38461538
p_int: 0.868966653
p_ni: 0.131033338
p_wrong: 9e-9
Data Source: BioPlex
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.854763125
p_ni: 0.145236875
Data Source: BioPlex
PROC
Tchem
Family: Enzyme
Novelty: 0.00131977
p_int: 0.789299317
p_ni: 0.210700299
p_wrong: 3.84e-7
Score: 0.95
Data Source: BioPlex,Reactome,STRINGDB
ZPBP2
Tbio
Novelty: 0.09882649
p_int: 0.776042871
p_ni: 0.223957129
Score: 0.295
Data Source: BioPlex,STRINGDB
BMP4
Tchem
Novelty: 0.00057391
p_int: 0.768656534
p_ni: 0.231343466
Score: 0.272
Data Source: BioPlex,STRINGDB
GGCX
Tclin
Family: Enzyme
Novelty: 0.01163709
Score: 0.973
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  2719.55

PubMed score by year
PubTator Score  176.95

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEARE
1-70
VFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKAS
70-140
FTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPS
140-210
ICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQK
210-280
SCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWL
280-350
LIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL
350-420
LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGI
420-490
AQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIY
490-560
RIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSAT
560-630
PVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS
630-676
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS