You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KLK1
Kallikrein-1

Protein Summary
Description
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. This protein is functionally conserved in its capacity to release the vasoactive peptide, Lys-bradykinin, from low molecular weight kininogen. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000301420
  • ENSP00000301420
  • ENSG00000167748

Symbol
  • hK1
  • KLKR
  • Klk6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.71
disease
0.7
cellular component
0.68
chemical
0.6
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 469.77   (req: < 5)
Gene RIFs: 75   (req: <= 3)
Antibodies: 400   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 469.77   (req: >= 5)
Gene RIFs: 75   (req: > 3)
Antibodies: 400   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 79
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
nafamostat
chemical structure image
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (52)
1 – 10 of 52
UBA52
Tbio
Novelty: 0.01006012
p_int: 0.999745577
p_ni: 0.000249031
p_wrong: 0.000005392
Data Source: BioPlex
TAMM41
Tbio
Family: Enzyme
Novelty: 0.08219178
p_int: 0.998377164
p_ni: 0.001622537
p_wrong: 2.99e-7
Data Source: BioPlex
SLC25A20
Tbio
Family: Transporter
Novelty: 0.00531784
p_int: 0.990766285
p_ni: 0.009073019
p_wrong: 0.000160696
Data Source: BioPlex
PTPMT1
Tbio
Family: Enzyme
Novelty: 0.0579112
p_int: 0.937104826
p_ni: 0.062894936
p_wrong: 2.38e-7
Data Source: BioPlex
NSUN3
Tbio
Family: Enzyme
Novelty: 0.27368602
p_int: 0.933313635
p_ni: 0.06649924
p_wrong: 0.000187126
Data Source: BioPlex
SLC25A15
Tbio
Family: Transporter
Novelty: 0.00604456
p_int: 0.930762924
p_ni: 0.069234563
p_wrong: 0.000002513
Data Source: BioPlex
SLC16A10
Tbio
Family: Transporter
Novelty: 0.03767726
p_int: 0.921406065
p_ni: 0.076384226
p_wrong: 0.002209709
Data Source: BioPlex
MTX3
Tdark
Novelty: 0.0360262
p_int: 0.840178588
p_ni: 0.154149385
p_wrong: 0.005672028
Data Source: BioPlex
SLC25A4
Tbio
Family: Transporter
Novelty: 0.01081101
p_int: 0.834736552
p_ni: 0.165263448
Data Source: BioPlex
RPL23
Tbio
Novelty: 0.02634055
p_int: 0.831950397
p_ni: 0.168049603
Data Source: BioPlex
Publication Statistics
PubMed Score  469.77

PubMed score by year
PubTator Score  185.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDN
1-70
YQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVV
70-140
ELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTC
140-210
VGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
210-262
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS