You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CDK1
Cyclin-dependent kinase 1

Protein Summary
Description
Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset; promotes G2-M transition, and regulates G1 progress and G1-S transition via association with multiple interphase cyclins. Required in higher cells for entry into S-phase and mitosis. Phosphorylates PARVA/actopaxin, APC, AMPH, APC, BARD1, Bcl-xL/BCL2L1, BRCA2, CALD1, CASP8, CDC7, CDC20, CDC25A, CDC25C, CC2D1A, CENPA, CSNK2 proteins/CKII, FZR1/CDH1, CDK7, CEBPB, CHAMP1, DMD/dystrophin, EEF1 proteins/EF-1, EZH2, KIF11/EG5, EGFR, FANCG, FOS, GFAP, GOLGA2/GM130, GRASP1, UBE2A/hHR6A, HIST1H1 proteins/histone H1, HMGA1, HIVEP3/KRC, LMNA, LMNB, LMNC, LBR, LATS1, MAP1B, MAP4, MARCKS, MCM2, MCM4, MKLP1, MYB, NEFH, NFIC, NPC/nuclear pore complex, PITPNM1/NIR2, NPM1, NCL, NUCKS1, NPM1/numatrin, ORC1, PRKAR2A, EEF1E1/p18, EIF3F/p47, p53/TP53, NONO/p54NRB, PAPOLA, PLEC/plectin, RB1, UL40/R2, RAB4A, RAP1GAP, RCC1, RPS6KB1/S6K1, KHDRBS1/SAM68, ESPL1, SKI, BIRC5/survivin, STIP1, TEX ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316629
  • ENSP00000325970
  • ENSG00000170312
  • ENST00000373809
  • ENSP00000362915
  • ENST00000395284
  • ENSP00000378699

Symbol
  • CDC2
  • CDC28A
  • CDKN1
  • P34CDC2
  • CDC2
  • CDC28A
  • P34CDC2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
hub protein
1
interacting protein
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1891.67   (req: < 5)
Gene RIFs: 351   (req: <= 3)
Antibodies: 2457   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1891.67   (req: >= 5)
Gene RIFs: 351   (req: > 3)
Antibodies: 2457   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 59
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 199
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (109)
APC/C-mediated degradation of cell cycle proteins (R-HSA-174143)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 71
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Reactome
APC:Cdc20 mediated degradation of cell cycle proteins prior to satisfation of the cell cycle checkpoint
Reactome
AURKA Activation by TPX2
Name
Explore in Pharos
Explore in Source
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of mitotic proteins
APC:Cdc20 mediated degradation of cell cycle proteins prior to satisfation of the cell cycle checkpoint
AURKA Activation by TPX2
Gene Ontology Terms (75)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (979)
1 – 10 of 979
CKS1B
Tbio
Family: Enzyme
Novelty: 0.00986309
p_int: 1
Score: 0.999
Data Source: BioPlex,STRINGDB
CKS2
Tbio
Family: Enzyme
Novelty: 0.03208125
p_int: 1
Score: 0.999
Data Source: BioPlex,STRINGDB
CCNA2
Tchem
Novelty: 0.00061948
p_int: 0.999999958
p_ni: 4.2e-8
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
CCNB2
Tbio
Novelty: 0.01021878
p_int: 0.999997675
p_ni: 0.000002325
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
CCNB1
Tchem
Novelty: 0.00068627
p_int: 0.999990498
p_ni: 0.000009502
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
PKMYT1
Tchem
Family: Kinase
Novelty: 0.04783054
p_int: 0.999934141
p_ni: 0.000065858
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
SKP2
Tbio
Family: Enzyme
Novelty: 0.00202287
p_int: 0.999430446
p_ni: 0.000569554
Score: 0.935
Data Source: BioPlex,STRINGDB
CDK3
Tchem
Family: Kinase
Novelty: 0.04846001
p_int: 0.998703285
p_ni: 0.001296715
Score: 0.878
Data Source: BioPlex,STRINGDB
CDT1
Tbio
Novelty: 0.00565545
p_int: 0.998630143
p_ni: 0.001320007
p_wrong: 0.00004985
Score: 0.99
Data Source: BioPlex,STRINGDB
CDKN1B
Tbio
Family: Enzyme
Novelty: 0.00079036
p_int: 0.998168939
p_ni: 0.001831061
Score: 0.964
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1891.67

PubMed score by year
PubTator Score  2343.37

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVL
1-70
MQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKG
70-140
TIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEI
140-210
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM
210-280
ALNHPYFNDLDNQIKKM
280-297
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM