You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CD1A
T-cell surface glycoprotein CD1a

Protein Summary
Description
Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to the plasma membrane and to recycling vesicles of the early endocytic system. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000289429
  • ENSP00000289429
  • ENSG00000158477

Symbol
  • R4
  • T6
  • CD1
  • FCB6
  • HTA1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
hub protein
0.67
biological term
0.66
metabolite
0.62
gene perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2086.23   (req: < 5)
Gene RIFs: 65   (req: <= 3)
Antibodies: 1841   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2086.23   (req: >= 5)
Gene RIFs: 65   (req: > 3)
Antibodies: 1841   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (159)
1 – 10 of 159
TMEM120A
Tdark
Novelty: 1.18644068
p_int: 0.996736025
p_ni: 0.001141131
p_wrong: 0.002122845
Data Source: BioPlex
SUSD1
Tdark
Novelty: 2.91666667
p_int: 0.995915863
p_ni: 0.004083555
p_wrong: 5.82e-7
Data Source: BioPlex
TMEM59L
Tbio
Novelty: 0.08727273
p_int: 0.991645211
p_ni: 0.007349734
p_wrong: 0.001005055
Data Source: BioPlex
CANX
Tbio
Novelty: 0.00135361
p_int: 0.991025366
p_ni: 0.008974635
Data Source: BioPlex
KCNJ8
Tbio
Family: IC
Novelty: 0.00457979
p_int: 0.983238195
p_ni: 0.016761804
p_wrong: 1e-9
Data Source: BioPlex
GATB
Tbio
Family: Enzyme
Novelty: 0.0265185
p_int: 0.975842486
p_ni: 0.024157505
p_wrong: 9e-9
Data Source: BioPlex
PURB
Tbio
Novelty: 0.026792
p_int: 0.973218777
p_ni: 0.026777649
p_wrong: 0.000003574
Data Source: BioPlex
HLA-DPA1
Tbio
Novelty: 0.01432663
p_int: 0.963925609
p_ni: 0.035068639
p_wrong: 0.001005751
Data Source: BioPlex
MFAP3
Tdark
Novelty: 1.07142857
p_int: 0.961147703
p_ni: 0.038852215
p_wrong: 8.2e-8
Data Source: BioPlex
HLA-B
Tbio
Novelty: 0.01289492
p_int: 0.95709585
p_ni: 0.04290415
Score: 0.172
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  2086.23

PubMed score by year
PubTator Score  1212.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLCPW
1-70
SRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDF
70-140
VSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSH
140-210
GPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRV
210-280
KHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC
280-327
MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC