You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MYL1
Myosin light chain 1/3, skeletal muscle isoform

Protein Summary
Description
Regulatory light chain of myosin. Does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000341685
  • ENSP00000343321
  • ENSG00000168530
  • ENST00000352451
  • ENSP00000307280

Symbol
  • MLC1F
  • MLC3F
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.69
cell type or tissue
0.61
cell line
0.59
cellular component
0.54
interacting protein
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 294.28   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 169   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 294.28   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 169   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Muscle contraction (R-HSA-397014)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Muscle contraction
Reactome
Striated Muscle Contraction
Name
Explore in Pharos
Explore in Source
Muscle contraction
Striated Muscle Contraction
Gene Ontology Terms (9)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Non-traceable Author Statement (NAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (162)
1 – 10 of 162
RBMX2
Tbio
Novelty: 0.09405059
p_int: 0.997730886
p_ni: 0.000003074
p_wrong: 0.00226604
Data Source: BioPlex
TLE3
Tbio
Novelty: 0.02798931
p_int: 0.997513101
p_ni: 1.4e-8
p_wrong: 0.002486885
Score: 0.214
Data Source: BioPlex,STRINGDB
MECOM
Tbio
Family: TF; Epigenetic
Novelty: 0.00805252
p_int: 0.995419913
p_ni: 0.000001346
p_wrong: 0.004578741
Data Source: BioPlex
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
p_int: 0.978943081
p_ni: 0.000001495
p_wrong: 0.021055424
Score: 0.347
Data Source: BioPlex,STRINGDB
NEB
Tbio
Novelty: 0.00316169
Score: 0.996
Data Source: STRINGDB
TNNT3
Tbio
Novelty: 0.0268478
Score: 0.995
Data Source: STRINGDB
TNNI2
Tbio
Novelty: 0.04330206
Score: 0.995
Data Source: STRINGDB
TTN
Tbio
Family: Kinase
Novelty: 0.00054314
Score: 0.994
Data Source: Reactome,STRINGDB
TNNC2
Tbio
Novelty: 0.11856592
Score: 0.993
Data Source: STRINGDB
MYH8
Tbio
Novelty: 0.01203725
Score: 0.991
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  294.28

PubMed score by year
PubTator Score  61.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKI
1-70
TLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFD
70-140
KEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
140-194
MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI