Protein Classes
Protein Summary
Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'. Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed:24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed:24623306). This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008]
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 6471.97 (req: < 5)
Gene RIFs: 726 (req: <= 3)
Antibodies: 3423 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 6471.97 (req: >= 5)
Gene RIFs: 726 (req: > 3)
Antibodies: 3423 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 80
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 55
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Active Ligands (55)
1 – 10 of 55
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (266)
Reactome (55)
KEGG (50)
PathwayCommons (90)
WikiPathways (71)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 55
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Activation of HOX genes during differentiation | ||||
Reactome | Activation of anterior HOX genes in hindbrain development during early embryogenesis | ||||
Reactome | Activation of the AP-1 family of transcription factors | ||||
Reactome | Cellular Senescence | ||||
Reactome | Cellular responses to external stimuli | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Activation of HOX genes during differentiation | ||||
Activation of anterior HOX genes in hindbrain development during early embryogenesis | ||||
Activation of the AP-1 family of transcription factors | ||||
Cellular Senescence | ||||
Cellular responses to external stimuli | ||||
Gene Ontology Terms (89)
Functions (23)
Components (9)
Processes (57)
Items per page:
10
1 – 10 of 23
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | CAFA | |||
Inferred from Direct Assay (IDA) | CAFA | |||
Inferred from Direct Assay (IDA) | BHF-UCL | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Protein-Protein Interactions (945)
1 – 10 of 945
FOS
Family: TF
Novelty: 0.00007002
p_int: 0.9999958
p_ni: 0.0000042
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
FOSL2
Family: TF
Novelty: 0.006377
p_int: 0.999995346
p_ni: 0.000004654
Score: 0.996
Data Source: BioPlex,STRINGDB
ATF2
Family: TF
Novelty: 0.00562547
p_int: 0.999971494
p_ni: 0.000025679
p_wrong: 0.000002827
Score: 0.992
Data Source: BioPlex,Reactome,STRINGDB
BATF3
Family: TF
Novelty: 0.01678998
p_int: 0.999968347
p_ni: 0.000031652
p_wrong: 1e-9
Score: 0.991
Data Source: BioPlex,STRINGDB
PPP2R2D
Family: Enzyme
Novelty: 0.10054323
p_int: 0.999947452
p_ni: 0.000046667
p_wrong: 0.000005881
Score: 0.153
Data Source: BioPlex,STRINGDB
RALBP1
Novelty: 0.0094994
p_int: 0.999728618
p_ni: 0.000271382
p_wrong: 1e-9
Score: 0.239
Data Source: BioPlex,STRINGDB
ARIH1
Family: Enzyme
Novelty: 0.00502889
p_int: 0.99953628
p_ni: 0.000463719
p_wrong: 1e-9
Data Source: BioPlex
CREB5
Family: TF
Novelty: 0.09663345
p_int: 0.998985126
p_ni: 0.001014874
Score: 0.922
Data Source: BioPlex,STRINGDB
JUNB
Family: TF
Novelty: 0.01119828
p_int: 0.99885311
p_ni: 0.001146849
p_wrong: 4.2e-8
Score: 0.982
Data Source: BioPlex,STRINGDB
ARHGAP22
Family: Enzyme
Novelty: 0.20584913
p_int: 0.998556272
p_ni: 0.001443728
Data Source: BioPlex
Publication Statistics
PubMed Score 6471.97
PubMed score by year
PubTator Score 3846.45
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
1-70
LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGA
70-140
GMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHH
140-210
LPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARL
210-280
EEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
280-331
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Find similar targets by: