You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RPLP1
60S acidic ribosomal protein P1

Protein Summary
Description
Plays an important role in the elongation step of protein synthesis. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P2. The P1 protein can interact with P0 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Two alternatively spliced transcript variants that encode differen ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260379
  • ENSP00000346037
  • ENSG00000137818
  • ENST00000357790
  • ENSP00000350437

Symbol
  • RRP1
  • P1
  • LP1
  • RPP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
microRNA
1
small molecule perturbation
1
ligand (protein) perturbation
0.96
hub protein
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.38   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 139   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.38   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 139   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 32
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Cap-dependent Translation Initiation
Reactome
Developmental Biology
Reactome
Disease
Reactome
Eukaryotic Translation Elongation
Name
Explore in Pharos
Explore in Source
Axon guidance
Cap-dependent Translation Initiation
Developmental Biology
Disease
Eukaryotic Translation Elongation
Protein-Protein Interactions (357)
1 – 10 of 357
RRS1
Tbio
Novelty: 0.00929224
p_int: 0.986319347
p_ni: 0.013680652
Score: 0.505
Data Source: BioPlex,STRINGDB
CNBP
Tbio
Novelty: 0.0006668
p_int: 0.895331147
p_ni: 0.104668851
p_wrong: 2e-9
Score: 0.422
Data Source: BioPlex,STRINGDB
RPL31
Tbio
Novelty: 0.05590003
Score: 0.999
Data Source: STRINGDB
RPL27A
Tbio
Novelty: 0.04335303
Score: 0.999
Data Source: STRINGDB
RPS18
Tbio
Novelty: 0.01418961
Score: 0.999
Data Source: STRINGDB
RPS10
Tbio
Novelty: 0.0175695
Score: 0.999
Data Source: STRINGDB
RPL17
Tbio
Novelty: 0.06372809
Score: 0.999
Data Source: STRINGDB
RPS4X
Tbio
Novelty: 0.02388658
Score: 0.999
Data Source: STRINGDB
RPL37A
Tbio
Novelty: 0.03125092
Score: 0.999
Data Source: STRINGDB
RPL38
Tbio
Novelty: 0.03973772
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.38

PubMed score by year
PubTator Score  132.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAP
1-70
AAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD
70-114
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD