You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PCCB
Propionyl-CoA carboxylase beta chain, mitochondrial

Protein Classes
Protein Summary
Description
The protein encoded by this gene is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. This gene encodes the beta subunit of PCC. Defects in this gene are a cause of propionic acidemia type II (PA-2). Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251654
  • ENSP00000251654
  • ENSG00000114054
  • ENST00000469217
  • ENSP00000419027
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.96
transcription factor perturbation
0.94
transcription factor binding site profile
0.92
histone modification site profile
0.87
molecular function
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.91   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 188   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.91   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 188   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (24)
Biotin transport and metabolism (R-HSA-196780)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biotin transport and metabolism
Reactome
Defective HLCS causes multiple carboxylase deficiency
Reactome
Defects in biotin (Btn) metabolism
Reactome
Defects in vitamin and cofactor metabolism
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Biotin transport and metabolism
Defective HLCS causes multiple carboxylase deficiency
Defects in biotin (Btn) metabolism
Defects in vitamin and cofactor metabolism
Disease
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (107)
1 – 10 of 107
ARNT
Tbio
Family: TF
Novelty: 0.00291828
p_int: 0.999562282
p_ni: 0.000437718
Data Source: BioPlex
PCCA
Tbio
Family: Enzyme
Novelty: 0.00596427
p_int: 0.99521455
p_ni: 0.000326249
p_wrong: 0.004459201
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
HMGCL
Tbio
Family: Enzyme
Novelty: 0.03613197
p_int: 0.976122253
p_ni: 0.023877698
p_wrong: 4.9e-8
Score: 0.415
Data Source: BioPlex,STRINGDB
DHRS4
Tbio
Family: Enzyme
Novelty: 0.02859799
p_int: 0.88142394
p_ni: 0.097464857
p_wrong: 0.021111203
Data Source: BioPlex
MCCC1
Tbio
Family: Enzyme
Novelty: 0.01062574
Score: 0.984
Data Source: STRINGDB
BCKDHB
Tbio
Family: Enzyme
Novelty: 0.03
Score: 0.983
Data Source: STRINGDB
MCEE
Tbio
Family: Enzyme
Novelty: 0.07926976
Score: 0.982
Data Source: STRINGDB
ALDH6A1
Tbio
Family: Enzyme
Novelty: 0.05651741
Score: 0.962
Data Source: STRINGDB
PC
Tbio
Family: Enzyme
Novelty: 0.00322567
Score: 0.962
Data Source: STRINGDB
HLCS
Tchem
Family: Enzyme
Novelty: 0.00489358
Score: 0.96
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  64.91

PubMed score by year
PubTator Score  49.3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERI
1-70
SLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQK
70-140
ICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPAL
140-210
TDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPL
210-280
SSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGR
280-350
TVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFA
350-420
EATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKF
420-490
ANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL
490-539
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKVQRPWRKHANIPL