You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HSPB1
Heat shock protein beta-1

Protein Summary
Description
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state (PubMed:10383393, PubMed:20178975). Plays a role in stress resistance and actin organization (PubMed:19166925). Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins (PubMed:23728742). This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000248553
  • ENSP00000248553
  • ENSG00000106211

Symbol
  • HSP27
  • HSP28
  • CMT2F
  • HMN2B
  • HSP27
  • HSP28
  • Hsp25
  • SRP27
  • HS.76067
  • HEL-S-102
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
interacting protein
1
hub protein
0.99
kinase
0.99
PubMedID
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1045.96   (req: < 5)
Gene RIFs: 377   (req: <= 3)
Antibodies: 2874   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1045.96   (req: >= 5)
Gene RIFs: 377   (req: > 3)
Antibodies: 2874   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (31)
AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
AUF1 (hnRNP D0) binds and destabilizes mRNA
Reactome
MAPK family signaling cascades
Reactome
MAPK6/MAPK4 signaling
Reactome
Metabolism of RNA
Reactome
Regulation of mRNA stability by proteins that bind AU-rich elements
Name
Explore in Pharos
Explore in Source
AUF1 (hnRNP D0) binds and destabilizes mRNA
MAPK family signaling cascades
MAPK6/MAPK4 signaling
Metabolism of RNA
Regulation of mRNA stability by proteins that bind AU-rich elements
Gene Ontology Terms (42)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (275)
1 – 10 of 275
CRYAA
Tbio
Novelty: 0.03207592
p_int: 0.98547877
p_ni: 0.01452123
Score: 0.525
Data Source: BioPlex,STRINGDB
HSPB6
Tbio
Novelty: 0.00415122
p_int: 0.982747402
p_ni: 0.017252598
Score: 0.611
Data Source: BioPlex,STRINGDB
CRYAB
Tbio
Novelty: 0.00547363
p_int: 0.979093485
p_ni: 0.020906505
p_wrong: 1e-8
Score: 0.513
Data Source: BioPlex,STRINGDB
HSPB2
Tbio
Novelty: 0.00125204
p_int: 0.918450689
p_ni: 0.081549311
Score: 0.196
Data Source: BioPlex,STRINGDB
MAPKAPK2
Tchem
Family: Kinase
Novelty: 0.00521234
Score: 0.993
Data Source: STRINGDB
DAXX
Tbio
Novelty: 0.00430069
Score: 0.991
Data Source: STRINGDB
MAPK14
Tchem
Family: Kinase
Novelty: 0.00018655
Score: 0.99
Data Source: STRINGDB
MAPKAPK5
Tchem
Family: Kinase
Novelty: 0.01278004
Score: 0.984
Data Source: Reactome,STRINGDB
CYCS
Tchem
Novelty: 0.00018258
Score: 0.984
Data Source: STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
Score: 0.984
Data Source: STRINGDB
Publication Statistics
PubMed Score  1045.96

PubMed score by year
PubTator Score  1419.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAA
1-70
PAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR
70-140
KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
140-205
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK